KEGG   Burkholderia sp. PAMC 26561: AXG89_10160Help
Entry
AXG89_10160       CDS       T05481                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00440  Phosphonate and phosphinate metabolism
bum01100  Metabolic pathways
bum01120  Microbial metabolism in diverse environments
bum01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AXG89_10160
Enzymes [BR:bum01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AXG89_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL Rsa3 NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: AME24155
UniProt: A0A0X8L5A7
LinkDB All DBs
Position
1:2208694..2210400
Genome map
AA seq 568 aa AA seqDB search
MNAPYQLPAAYARSLRLREMLQSNELEFLMEAHNGLSARIVKEAGFKAIWGSGLTISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIE
DKQFPKTNSFLNGERQPLAEMDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSKPDEILTFAREWAGRGPLVIVPTKYYSTPTDVFRQAGIST
VIWANHLLRGAASTMQAIAKEIHTSQTLVNVEDRVASVNEIFRLQDAEEYSTAEGVYLSS
ASASRNAVVLAASRGAGLEAVTADKPKVMLPIAGKPLLRRLVEAFKKEGINDITVVGGYR
ADAIDTSGVRLVVNEKHEQTGELASLACAAKSFTADTVISYGDLLFRSYILRDLVESDSD
FCVVVDSSQTPQAGVASTDFAFCSTADDRALFGQKVWLESVTSSAAPANVESKAPQGRWM
GLLNVRGAGRERLVATLEQLQRRDDFARLDMAALLNALIAAGERIEVQYVHGHWRGVNDL
DELRQAGDFAHGQAPYGSNGSSGAEAGA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccgtatcaactgcccgcggcttatgcccgttcccttcgtctgcgcgaaatg
cttcaaagcaatgagctcgaattcctgatggaagcgcacaacggcttgtcggcgcgcatt
gtcaaggaagccggcttcaaggcgatctggggctcgggcctgacgatctccgcgcagttc
ggcgtacgcgacaacaacgaagcaagctggacgcaagtggtcgacacgctcgagttcatg
gcggatgccagcgaccttcctatcctgctcgacggcgacactggttacggcaacttcaat
aatgtccgccggttggtgaagaagctggaacagcgcggtattgcaggcgtgtgtattgag
gacaagcagtttccaaagacgaactctttcctgaacggtgagcgccagccgctcgccgag
atggacgagttctgcggcaagatcaaggccggcaaggattcgcaaagcgatccgaatttc
tcgatcgtcgcgcgcgttgaagcgttgattgccggctggggcatggaagaggcgctgaag
cgcgccgaggcttatcgccaagccggtgcggacgccatcctgattcacagcaagctgtcg
aagcccgacgagatcctcacgttcgcacgtgaatgggccggccgcggcccgctcgtgatc
gtgccgaccaagtactacagcacgccaaccgatgtctttcgtcaggccggcatcagcacg
gtgatctgggcgaaccatttgctgcgcggcgcggcatcgaccatgcaggctatcgcgaag
gaaatccacaccagccagacgctcgtgaacgtggaagaccgcgtggcgagcgtgaacgag
atcttccgtctgcaggacgccgaagagtattcgacggccgagggcgtgtatctgtcgtcg
gcgagcgcatcgcgtaacgcggttgttctggcggcaagccggggcgcaggcctcgaagcc
gtcaccgccgacaaacccaaggtgatgctgccgatcgcgggcaagccgctgctgcgccgc
ctggtcgaagcgttcaagaaggaaggcatcaacgacatcacggtggtgggcggttatcgc
gctgatgccatcgatacatcgggcgttcgccttgtagtgaacgaaaagcatgagcagacg
ggtgaactggcttcgctcgcatgcgcagcgaaatcgttcacggccgacacggtcatctcg
tacggcgacctcttgttccgcagctacattcttcgcgatctggtggagtccgacagcgac
ttctgcgtggtcgtggattcgtcgcagacgccgcaagccggggttgcatcgacggacttt
gcgttctgctccaccgccgatgaccgcgcgctcttcggccagaaagtctggctcgaaagc
gtcacgagctcggccgctccggcaaacgtggaatcgaaagcgccgcaaggccgctggatg
ggcttgctcaacgtccgcggcgcgggccgcgagcgtctggtcgccacgctcgaacaactg
caacgacgcgatgactttgccaggctcgacatggccgcgctgctcaacgcactgatcgcg
gcgggcgagcgcatcgaagtgcaatacgtgcatggccactggcgcggcgtgaacgacctc
gacgaactgcgtcaagccggtgacttcgctcacgggcaagcaccgtacggatcgaacgga
tcgtcgggcgcggaggcaggcgcgtga

DBGET integrated database retrieval system