KEGG   Burkholderia sp. PAMC 26561: AXG89_14040Help
Entry
AXG89_14040       CDS       T05481                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bum00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AXG89_14040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bum03400]
    AXG89_14040
Enzymes [BR:bum01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AXG89_14040
DNA repair and recombination proteins [BR:bum03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AXG89_14040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AME24809
UniProt: A0A0X8L6M7
LinkDB All DBs
Position
1:complement(3080377..3083202)
Genome map
AA seq 941 aa AA seqDB search
MAGKLETYQRMRRFNQTPEPSGDAAEKAKARRASKKAQASELSFVIQEHDARRLHYDFRL
ELDGTLKSWAVPKGPSLDPSVKRLAVHVEDHPIDYGSFEGAIPEGNYGAGSVIVWDRGTW
EPQSGSIDEARATYEKGKLKFVLHGDKLQGGWTLVRSHMRGNGDKEQWLLIKERDDEARN
EADYDVLLKKPGSVMSDSLGARTKSGEVRERAERKSAAKTTKAAPSPKRPAVKDKGTSPE
RPRPDIVANRSAESLRTLADNPAIQDAVKAKLPATMKPQLATLVDASPSSDDWTYEIKFD
GYRIMIRIDREGGAKPKAARAQFFTRNGHDWTDKFSREVKALDKLDVQNAWLDGEAVVLD
DNDLPNFQKLQNAFDTNRPQDIAIYFFDIPFLNGYDLRNVPLIQRRAILQALLEPLDDDV
LRFSADFEFGADDLLKSACDMALEGIIGKRRDSTYTSGRSNSWIKLKCRRRQEFVVGGYS
EPTGSRGEFGALLLGVYDAKGKLQYAGRVGSGFNAGTLRDIKKQLDKREIQKMPFASAPK
ERSRTPVHWVTPELVAECNFAEWTSERIVRQASFVSLRTDKPAKEIVKEEPKSTKEVALN
DENEVAAAPAKKSAAKSVSKTNAVAKKAPAKKAPPKKAAAKKTAGAELVAGVKISHPERV
LDPSTGVSKLDLALYYEAVAPWMLPHLKDRPVSLVRAPGDIGGEMFFQKHSEKLTIPNVK
QHPGIDPGHPALITIENVGALVGAAQMGTIEMHTWNALAAKLEKPDRMVFDLDPGEGLGW
DRMKEAARLTRELLEELGLASFCKTSGGKGLHVVVPLTPQAGWDEVKGFSQAVAQHMAGA
LPKYFSAKMGKQNRQDKIFVDYLRNNRGSSTVAAYSLRARPGMGASVPIGWDELDATTAG
DQWNIGNLHERLDELDADPWAEYWKTKQRISAAMKKRLDIK
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaactcgaaacctatcagcgcatgcggcgtttcaaccagacgccggaacct
tccggcgacgctgctgaaaaagctaaagcccgacgcgcatcgaaaaaggcgcaggcgagc
gagctttcgttcgtcattcaggagcacgacgcacgccggcttcactacgacttccggctc
gaactcgacggcacgctgaagtcgtgggccgtgccgaaggggccgagcctggatccatcg
gttaaacggcttgctgtgcatgtcgaggaccatccgatcgattacggttcgttcgaaggc
gcgatccccgaaggcaattacggcgcgggcagcgtaatcgtctgggatcgcgggacgtgg
gagccgcaaagcgggagtatcgatgaagcgcgcgccacgtatgaaaagggcaagctcaag
ttcgtgcttcatggcgacaagctgcagggcggctggacgctcgtgcgcagccatatgcgc
ggcaatggcgacaaagaacagtggttgctgatcaaggaacgcgacgacgaagcccgcaac
gaagccgactacgacgttttgctcaagaagcccggcagtgtgatgagcgattcgcttggc
gcgcgcacgaaaagcggtgaggtgcgcgagcgcgccgagcgcaagagcgcagcgaagacg
acgaaagcggcgccatccccaaagcggcctgccgtcaaggacaagggaacgagtcccgag
cggccgcggccggacatcgtcgcgaaccgcagcgctgaatcgctgcgcaccctcgccgat
aaccccgccatccaggacgcggtcaaggcgaaactccccgccaccatgaaaccgcaactt
gcgacgctcgtggacgcgtcgccttcgagcgatgactggacgtacgagatcaagttcgat
ggatatcggatcatgatccgcatagaccgcgagggcggtgcaaagccaaaggcagcgcga
gcgcaattctttacgcgcaacggccacgactggaccgacaagttcagccgtgaggtcaag
gcgctcgacaagctcgatgtacagaacgcatggcttgacggcgaagccgtcgtgctggac
gacaacgatctgccgaatttccagaagctgcagaacgccttcgatacaaaccgtccgcaa
gacatcgcgatctatttcttcgatatcccttttctgaatggttacgacctgcgcaacgtg
ccgctgatccagcgccgggcgatcctgcaagcgctactggaaccgctggacgacgacgta
ctgcgcttttcggcggacttcgaattcggcgcggacgatctgttgaaaagtgcgtgcgac
atggcgctggaaggaatcatcggcaagcgtcgcgacagcacttatacgtctgggcgcagc
aatagctggatcaagctgaaatgcaggcggcggcaggagttcgtggtcggcggatactcg
gagcctactggcagccgtggcgagttcggcgccttgctgcttggcgtctacgatgcaaaa
ggcaagctgcaatacgctggccgcgtgggcagcggcttcaatgccggaaccctgcgcgat
atcaagaagcaactcgataaacgcgagattcaaaagatgccgtttgcgtcggcgccaaaa
gagcgcagccgtacgccggtgcattgggtcacgccggagctcgtcgccgagtgcaacttt
gccgagtggacgtctgagcggattgtccggcaggcatcgttcgtcagtttgagaaccgat
aaacccgcgaaagagatcgtgaaggaagagccgaaatcgacgaaggaggtcgcattgaac
gacgaaaacgaagtcgcagcggcgcccgcgaaaaaatcggcggcgaagtcggtgagcaaa
accaatgccgtcgccaagaaagccccagccaagaaagccccgcccaagaaagccgccgcg
aaaaaaaccgccggcgctgaactggttgccggcgtgaagatcagccatccggagcgcgtg
ctcgatccatcgacgggtgtcagcaagctcgaccttgccctttactacgaagccgtggcg
ccctggatgctgccgcatctgaaggaccgtcccgtgtcgctggttcgagcaccaggggat
atcggcggggagatgttctttcaaaagcacagcgaaaaactcacgatcccgaacgtgaaa
cagcatccgggtatcgatcctggacacccggcgctcatcacgatagaaaacgtcggcgcg
ctcgtcggcgcggcgcagatgggcaccattgaaatgcacacgtggaacgcgcttgcggcg
aagctggagaaacctgaccgcatggtcttcgacctcgatcccggcgaaggactcggctgg
gaccgcatgaaggaagccgcgcgtctcacgcgcgaactgctggaagaactcggccttgcc
tccttttgcaagacgagcggcggcaagggcttgcacgtagtcgtaccgctcacgccgcaa
gccggatgggatgaagtgaagggtttctcgcaagccgtcgcgcagcacatggccggcgcg
ttgccaaaatatttctcggcgaagatgggcaagcagaatcgtcaggacaagatcttcgtc
gattacctgcgcaataaccgcggctcaagcacggtcgccgcatactcattgcgcgcacgg
ccgggaatgggggcgtcggtgccgatcggctgggatgaactcgatgccaccacggccggc
gatcaatggaacatcggcaatctgcatgagcggctggacgaactcgacgccgatccatgg
gccgagtactggaagacgaaacaacgcatctccgctgccatgaaaaagcggctcgatatc
aaataa

DBGET integrated database retrieval system