KEGG   Burkholderia sp. PAMC 26561: AXG89_19985Help
Entry
AXG89_19985       CDS       T05481                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00020  Citrate cycle (TCA cycle)
bum00190  Oxidative phosphorylation
bum00650  Butanoate metabolism
bum01100  Metabolic pathways
bum01110  Biosynthesis of secondary metabolites
bum01120  Microbial metabolism in diverse environments
bum01130  Biosynthesis of antibiotics
bum01200  Carbon metabolism
Module
bum_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bum_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bum_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXG89_19985
   00650 Butanoate metabolism
    AXG89_19985
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AXG89_19985
Enzymes [BR:bum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AXG89_19985
    1.3.5.4  fumarate reductase (quinol)
     AXG89_19985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 FAD_binding_3 Thi4 HI0933_like GIDA FAD_oxidored Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AME26185
UniProt: A0A120KYF2
LinkDB All DBs
Position
2:998292..1000070
Genome map
AA seq 592 aa AA seqDB search
MAAIKTSLPRRRFDVVIVGAGGSGMRASLQLARAGLSVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPGAVYELEHMGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTHFFVEWMALDLIRDADG
DVLGVTALEMETGDVHILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIAMKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTLKGGYEEPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAG
NHIIKHAKEMKEHKPLPADAADAALERLAVLENSSSGEYTQAIANDIRATMQAHAGVFRT
SALLEEGVGKIKELSERVKHVHLKDKSKVFNTAKVEALELANLIEVARATMISAEARKES
RGAHAHSNFETRDDDNWMKHTLWFSEGDKLDYKPVHMTPLTVESVPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaattaaaacgtccctgccgcgtcgccgtttcgacgtcgtgatcgtgggtgca
ggtggttccggcatgcgcgcttcgctgcaactcgctcgtgcgggtttgtcggtcgcggtg
ctgtccaaggtattccccacgcgttcgcataccgtggccgcgcaaggcgggattggcgcg
tcgctcggcaacatgagcgaagacaactggcattaccacttctacgacaccatcaagggc
tccgactggctcggcgaccaggatgcgatcgaattcatgtgccgcgaagcccccggtgct
gtctacgaacttgaacacatgggcatgccgttcgaccgcaacgccgacggcacgatctac
cagcgtccgttcggcggccacacggccaactacggcgagaagccggttcagcgcgcatgc
gccgcggccgaccgtaccggccacgcgttgctgcacacgctgtatcagcagaacgtcgcg
gccaagacgcacttcttcgttgaatggatggcgctggacctgatccgcgacgccgacggc
gacgtgctcggcgtgaccgcgctggaaatggaaacgggcgacgtccacatcctcgaaggc
aagaccacgttgttcgcaacgggcggcgcgggccggatcttcgcggcatcgaccaatgcg
ttcatcaataccggcgacggactcggcatggccgcgcgttcgggcatcgccttgcaggac
atggaattctggcaattccatccgaccggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcggggcgaaggcggcattctgcgtaactcggacggcgagcgcttcatggaacgc
tacgcaccgacgctgaaggacctggcgccgcgtgacttcgtatcgcgttcaatggaccag
gaaatcaaggaaggccgcggcgtgggtccgaacaaggatcacgtgttgcttgacctttcg
cacatcggcgccgagaccatcatgaagcgtctcccgtcgatccgcgagatcgcgatgaag
ttcgcgaacgtcgattgcatcaaggaaccgattcccgttgttccgaccatccattaccag
atgggcggcattccgacgaacattcacggccaggtggtcggaacgctcaagggcggctac
gaagaaccggtcaacggcttctacgctgtcggcgaatgctcgtgtgtgtcggtgcacggc
gcgaaccgtctcggcacgaattcgctgctcgacctcgtggtgttcggccgtgcggccggc
aaccacatcatcaagcatgcgaaggaaatgaaggagcacaagccccttccggccgatgca
gccgacgcagcacttgaacgcctcgccgtgctggaaaactcgtcgtcgggcgaatacacg
caggccatcgcgaacgatatccgcgcgaccatgcaggcacacgctggtgtgttccgcacg
tccgcgctgctggaagaaggcgtgggcaagatcaaggaactgtccgagcgcgtgaagcat
gtgcacctgaaggacaagtcgaaggtcttcaacacggcgaaggtcgaagcgctcgaactc
gcgaacctgatcgaagtggcgcgcgccaccatgatttcagcggaagcgcgcaaggaaagc
cgcggtgcgcatgcgcacagcaacttcgaaacgcgcgacgacgacaactggatgaagcac
acgctgtggttcagcgaaggcgacaagctcgactacaagccggtgcacatgacgccgctg
acggtcgaatcggtgccgcccaaagcgcggaccttctaa

DBGET integrated database retrieval system