KEGG   Burkholderia sp. PAMC 26561: AXG89_22320Help
Entry
AXG89_22320       CDS       T05481                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bum  Burkholderia sp. PAMC 26561
Brite
KEGG Orthology (KO) [BR:bum00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXG89_22320
Enzymes [BR:bum01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AXG89_22320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored FAD_binding_2 FAD_binding_3 K_oxygenase HI0933_like DAO Thi4 FMO-like Thioredoxin_4 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AME26589
UniProt: A0A0X8L9X3
LinkDB All DBs
Position
2:complement(1525486..1527075)
Genome map
AA seq 529 aa AA seqDB search
MLEANLKTQLKAYLEKVSRPIEIVASLDDSPKSVELKDLLQEIATLSDRIAVIETRDDDQ
RKPSFSIGEPGKPTGIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDAVIEQIRSLDGDYQ
FETYISLSCQNCPEVVQALNVMALINPRIRQVTIDGALFQDEVEKRQIMAVPTVYMNGEV
FGQGRTGVKEILAKLDSNAGARAAKEIEGKGTFDVLIVGGGPAGAAAAIYAARKGISTGV
AAERFGGQVLDTLAIENFVSVKETEGPQFATALEQHVKSYEVDIMDVQRAEALLPGTIHE
VRLANGAVLKAKTIVLATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVSAVTLIEFGAELRADAVLQRKLRSMKNVTIITQAQTTEVTGDGKKV
NGLSYKDLRSGEAKHIELEGVFVQIGLVPNTEWLKGTVELSRHGEIVVDAKGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRNSVSEEVEVGAEEAVA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagccaacctcaagactcagttgaaagcgtatctggaaaaggtcagccggccg
atcgagatcgtcgcttccctcgatgactccccgaagtcggtcgaattgaaagacctgctc
caggaaatcgccacgctgtcggaccgcattgcggtgatcgaaacgcgtgacgacgaccag
cgcaagccgtcgttttccattggcgaaccgggcaagcctacgggcatccgcttcgcaggc
attccgatgggccatgaattcacctcgctcgtgctggcgctgctgcaaaccggcggccac
ccggtcaagctcgacgacgccgtgatcgaacagatccgctcgctcgacggcgactatcag
tttgaaacgtatatctcgttgtcatgccagaactgcccggaagtcgtgcaggcgctgaat
gtgatggcgctcatcaacccgcgcattcgccaggtcaccatcgacggcgcgttgttccag
gacgaagtcgagaagcgccagatcatggccgtgccgaccgtctacatgaatggcgaagtg
ttcggccagggccgcaccggcgtgaaggaaatcctcgccaagctcgacagcaacgctggc
gcgcgggctgcaaaggaaatcgaaggtaaaggcacgttcgacgtgctgatcgtcggcggc
ggacctgccggcgcggctgccgcaatctacgcggcgcgcaagggcatctcgacgggcgtt
gcggccgaacgcttcggcggccaggtgctggatacgctcgccatcgaaaattttgtctcg
gtgaaagagacggaaggaccgcagttcgcgacggcgctggaacagcacgtcaagagctac
gaggtggacatcatggacgtgcagcgtgccgaagcgctcttgccgggcacgatccacgaa
gtgcgcctcgccaacggcgcagtgctgaaagcgaagacgatcgtgctggcaaccggcgcc
cggtggcgcgaaatcaacgtgccgggtgagaaggaatatcgtaatcacggcgtggcctat
tgcccgcattgcgacggtcctctttttaagggcaagcgcgtagcggtgatcggcggcggt
aattccggcgtggaagcggcgatcgacctggcgggtattgtcagcgccgtgacgctgatc
gaattcggcgcagagttgcgtgccgatgccgtcctgcagcgcaagcttcgcagcatgaag
aacgtgacgatcatcacgcaagcgcagaccacggaagtcaccggcgacggcaagaaggtc
aacggtctttcgtacaaggatctgcgttcgggtgaagcgaagcacatcgagctggaaggt
gtgttcgtgcagatcggcctcgtgccgaataccgaatggctcaagggcacggtcgagcta
tcgcgccacggtgaaatcgtggtcgatgcgaagggcgcaacgtcggtgccgggtgtgttt
gctgccggcgacgtcaccaccgtgccgtacaagcagatcgtgattgcggtgggcgaaggc
gcaaaggcgtcgctgagcgcattcgattatttgatccgtaattcggtatcggaggaagtt
gaagttggcgcggaagaagcagtcgcttga

DBGET integrated database retrieval system