KEGG   Burkholderia sp. PAMC 26561: AXG89_31025Help
Entry
AXG89_31025       CDS       T05481                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00500  Starch and sucrose metabolism
bum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AXG89_31025
Enzymes [BR:bum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AXG89_31025
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AXG89_31025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AME28263
UniProt: A0A125SHS0
LinkDB All DBs
Position
unnamed3:239059..240720
Genome map
AA seq 553 aa AA seqDB search
MVNDLWYKNAIVYCLSVGTFMDANGDGIGDLQGLIRRLDYLQGLGVTTVWLMPFQPSPCR
DNGYDIADYYNVDPRYGTLGDFAEFTHACRQRGLRVMIDLVVNHTSNQHEWFQDARRNPA
SKYRDWYVWSKKKPTNAQDGVVFPGVQKSTWTYDKEARLWYFHRFYDFQPDLNTANPHVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGATVRQPVEQYGMLRTFREFLQWRKGDAII
LAEANVLPDTDFGYFGDDGDRLQMMFNFQVNQTTFYALASADTGPLKKALLATRPRPATA
QWGVFLRNHDELDLGRLTPDQRHAVFDAFGPNPNMQLYDRGIRRRLAPMLDGDRRRLELA
YSLMLTSPGTPVIRYGDEIGMGDDLRLPERECARTPMQWSGEPQGGFTKSSKPVSRVISG
GPYGFERVNVASQRRDPNSLLNWMERLIRMRRELPEISWGDFSILRIARTEVLGIRYEWR
NNAVLCLHNFGGAACTIKFKFGSNADETTLVNLLSDEHSTPDDRGSHTMVLEPYGYRWFR
VGGLDYLLKRSEV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgacctctggtacaagaacgcgattgtgtattgtttgtccgttggcactttt
atggatgcaaacggcgacggcatcggggacttgcagggcctgatccgcaggctcgactac
ctgcagggcctgggcgtgacgaccgtctggctcatgccgttccagccttcaccatgccgc
gacaatggctacgacatcgccgactactacaacgtcgatccgcgctacgggacgctcggc
gatttcgccgagttcacacatgcgtgccggcaacgcggtctgcgcgtaatgatcgatctc
gtcgtgaaccacacgtcgaatcagcacgaatggttccaggacgctcggcgcaatcccgca
tcgaagtatcgggactggtatgtctggtcgaagaagaagccaactaacgcccaagacggc
gtggtcttccctggcgtccagaagtcgacttggacttacgacaaagaagcaaggctctgg
tattttcatcgcttctacgacttccagccggacctgaacaccgcgaaccctcacgttcag
gcggaactcctgaagatcatgggtttctggattcaactgggcgtgtcaggtttccggatg
gacgccgtgccctttgtcatcgccactaaaggggcgaccgtgcgccagccggtcgagcag
tacggcatgcttcgtacgtttcgagagttcctgcaatggcgcaaaggcgacgcgatcatt
cttgccgaagccaacgttcttccagataccgacttcggttattttggcgacgatggtgat
cgtctgcagatgatgtttaatttccaggtcaatcagaccaccttttatgcgcttgcaagc
gccgataccggaccacttaagaaggcgctgttggcgacccggccccgtcccgcaaccgct
caatggggcgtctttctgcgcaatcacgacgagcttgatcttggacgtctgacgcccgat
caacgtcacgccgtgttcgatgcattcggaccgaatcccaacatgcagctctacgaccga
ggcatccggcggcggcttgccccgatgctagacggcgatcgccggcgtttggaactagcg
tatagcctcatgctaacgtccccaggaacaccggtgatccgttacggtgacgaaatcggc
atgggcgacgatttgcgtttgcccgagcgcgaatgcgcgcgtacacccatgcaatggtca
ggcgaaccgcaaggtggcttcacgaaaagtagtaagccggtttcgcgtgtgatatcgggt
ggcccatacggtttcgagcgcgtaaatgtcgcgagccagcggcgcgacccgaactccctt
cttaactggatggagcgcctgatccgtatgcgtcgcgagttaccggaaataagctggggc
gacttttcaatactgcgaattgcgagaacggaggttctcggcatacgctatgagtggcgc
aataacgccgtcctgtgccttcataactttggtggcgcagcctgcacgatcaaatttaag
ttcggctcgaacgcggacgaaactacgttggtgaatctgctctccgacgaacacagtaca
ccagatgatcgcggaagccatacgatggtgctcgagccttatggctatcgctggttccgg
gtcggcggtctcgattacctgcttaaaaggagcgaggtatga

DBGET integrated database retrieval system