KEGG   Burkholderia sp. PAMC 26561: AXG89_34570Help
Entry
AXG89_34570       CDS       T05481                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00010  Glycolysis / Gluconeogenesis
bum00620  Pyruvate metabolism
bum01100  Metabolic pathways
bum01110  Biosynthesis of secondary metabolites
bum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXG89_34570
   00620 Pyruvate metabolism
    AXG89_34570
Enzymes [BR:bum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AXG89_34570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: AMH42932
UniProt: A0A125SM93
LinkDB All DBs
Position
3:complement(103214..104734)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLNTDFPYKKQYGNFIGGQWVKPVGGEYFDNISPITGEAFTSIPRSREADIEL
ALDAAHKAKTAWGKTSPTERANILNKIADRMEANLTRIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGSISQIDNDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVFLELIEDLLPAGVLNVVNGFGLEAGKPLASNKRISKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMNADDSFFDKALEGFAMFALNQGEV
CTCPSRVLIEESIYDKFIERALKRVAAISQGHPLNASTMIGAQASQEQLEKILSYIDLGK
QEGAECLIGGERNTLDGELKNGYYIKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDEAQAL
EIANDTLYGLGAGVWTRDGTRAYRFGRDIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgctgagatgcagttcctgaacaccgacttcccgtacaaaaagcagtatggc
aacttcatcggtggacaatgggtcaagcccgtaggcggtgaatacttcgacaatatttcg
ccgatcacaggcgaagcgttcacgtccattccgcgctcgcgcgaagccgacatcgaactc
gcgcttgatgcagcgcacaaggccaagactgcgtggggcaagacttcgcccaccgagcgc
gcgaacatcctgaacaagatcgccgaccgtatggaagcgaatctgacgcgcatcgcggtg
gccgaaacaatcgacaacggcaagccgctacgcgaaaccatggccgcggatatcccgctt
gcaatcgatcacttccgctatttcgccggcgccgtgcgtgcgcaggaaggctcgatttct
caaatcgataacgacacggttgcctatcacttccacgaacccctaggtgtggtcgggcaa
atcattccgtggaatttcccgatcctgatggcggtatggaagcttgcgcccgcgcttgcc
gccggcaattgcgtggtcctgaaaccggcagaacaaacgccggcatcgatcctcgtgttc
ctcgaactgatcgaagacttgctgccggccggcgtgctgaacgtggtcaacggcttcggg
ctcgaagcgggcaagccgctggcatcgaacaaacgcatttcgaaaatcgcattcaccggc
gaaaccacgaccggccgcctgatcatgcagtacgcgagccagaacctgattccagtgacg
ctcgaactcggtggcaagagcccgaacatcttcttcgccgacgtgatgaacgcggacgac
agcttcttcgacaaggcgctcgaaggcttcgccatgttcgcgctgaatcagggcgaagtg
tgtacgtgtccgtcgcgtgtgctgattgaagagagcatctacgacaagttcatcgaacgt
gcgctcaagcgcgtggccgcaatcagccagggccatccgctcaatgccagcacgatgatc
ggcgcgcaagcctcgcaagagcaactggaaaagattctgtcgtatatcgatctgggcaag
caggaaggcgcggaatgcctgatcggtggcgagcgcaatacgctggatggcgaattgaag
aacggttattacatcaagccgaccgtgttcaaaggccacaacaagatgcgcatcttccag
gaggaaatcttcggaccggtggtgtcggtcacgactttcaaggatgaagcgcaagcgctc
gaaattgccaacgacacgctctatggtcttggtgcaggcgtgtggacacgcgatggtacg
cgggcttaccgattcggccgtgacatccaggccggccgcgtatggacgaattgctatcac
gcatacccggcgcacgcggcgttcggtggttacaagcaatctggcattggccgggaaaat
cacaagatgatgctcgaccactatcagcagacgaaaaacctgctggtaagttacagcgac
aaaccgctcggcttcttctaa

DBGET integrated database retrieval system