KEGG   Burkholderia sp. PAMC 26561: AXG89_35235
Entry
AXG89_35235       CDS       T05481                                 

Definition
(GenBank) hypothetical protein
  KO
K11890  type VI secretion system protein ImpM
Organism
bum  Burkholderia sp. PAMC 26561
Brite
KEGG Orthology (KO) [BR:bum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bum02044]
    AXG89_35235
Secretion system [BR:bum02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AXG89_35235
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: AMH43045
UniProt: A0A125SMK6
LinkDB
Position
3:complement(241359..241943)
AA seq 194 aa
MTTPEEAGTGFYGKVRTHGDFVGRGLSREFVVQWDTWLQRGLLKAQEQLGDAWLQDFLGM
PLWCFAMKPGVMDDTAYAGVMMPGIDAVGRYFPFVVARPMAQAFFDDWLHSSSVWYEHAA
GLALSTLKAKFSLAEFETELEQLDSGAETLVWRDKFRRFLSEGDVASVWWTSAQALHRHE
GAPDTALFLRLLGG
NT seq 585 nt   +upstreamnt  +downstreamnt
atgacgacgcctgaagaagccggcacgggcttctacggaaaagtgcgcacgcatggcgac
tttgtgggacgcggtttgtcgcgcgaatttgtcgtgcagtgggatacgtggttgcagcgc
ggattgctcaaggctcaggaacagcttggcgacgcctggttgcaagacttcctcggcatg
ccgctatggtgtttcgcgatgaaacccggggtgatggatgatacggcgtatgcgggcgtg
atgatgccgggtatcgacgcggtcgggcggtattttcctttcgtcgtggctcgaccaatg
gctcaagctttcttcgatgactggctgcacagcagttcggtgtggtacgagcatgcggcg
ggtttggccttatcgacgttgaaggcgaagttctcgctggcagagttcgagaccgagctg
gagcaacttgatagcggtgctgaaacgctggtctggcgcgataagttcaggcggtttttg
agcgagggcgatgttgcgagcgtttggtggacgagcgctcaagcgctgcacaggcacgag
ggcgcgccggatacggcgttgttcttgcgattgctgggaggttaa

DBGET integrated database retrieval system