KEGG   Bacteroides uniformis: Bun01g_09130Help
Entry
Bun01g_09130      CDS       T06523                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bun  Bacteroides uniformis
Brite
KEGG Orthology (KO) [BR:bun00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bun01g_09130
Enzymes [BR:bun01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bun01g_09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 FAD_oxidored DAO Thi4 AlaDh_PNT_C NAD_binding_8 NAD_binding_7 FAD_binding_3 Lycopene_cycl K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BBK86543
UniProt: A0A4Y1VC76
LinkDB All DBs
Position
complement(1273963..1275522)
Genome map
AA seq 519 aa AA seqDB search
MLETTILDQVRSVFQHLEARYVFHITYHPGHEQAQELIGFLKDVASCSDKLSCRMSEIEN
PVLEFTLLKDDVETGIKFRGIPGGHEFTSLLLAVLNADGKGKNLPDEAIRRRIRALQGDI
SLQTYVSLTCTNCPDVVQALNIIALLNPHVTHEMVDGALNQEEVDALKIQAVPSVYANGK
LLHVGRGSLGELLQKLEEAFGSAPQEDEAPIERDFDVLVLGGGPAGASAAIYSARKGLRV
AIVAERIGGQVKETVGIENLISVPQTTGAELANALRTHIEHYPIEIFEERKIEKVELQGT
EKSVSTVGGEMFHAPAVIIATGASWRKLNVEGEAEYIGRGVAFCPHCDGPFYQGKHVAVI
GGGNSGIEAAIDLAGICRKVTVFEFADTLKADQVLQEKARSLPNVEIFTSSQTVKVDGNR
EKVTSIRIKDRLTGEERDFPLDGIFVQIGLAANSAPFRDKLETTPAGEIKIDAFCRTTLP
GVYAAGDVSNVPYKQIAIAMGEGAKAALSAFDDRIRGVI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaacaactatattagaccaggtgcggagcgtattccagcatttggaagcccgc
tacgtctttcacatcacctatcatccgggtcacgagcaggcacaagagcttatcggattc
ttgaaggatgtggcaagctgttccgacaagctctcctgccggatgagtgagatagagaac
cccgtgttggagttcacattgctgaaagacgatgtggaaaccggcatcaagttccgcggc
atccccggcggacacgagttcacttccctcctgcttgccgtgctgaatgccgatggaaag
gggaaaaatctgccggacgaagcaattcgtcgccgcatccgggcgttgcaaggcgacatc
agcctgcaaacgtatgtatcgcttacttgcaccaactgtccggatgtggtgcaggcactg
aacatcatcgcattgctgaatccgcacgtcacccacgagatggtggacggggcgcttaat
caagaggaagtagatgcgctgaagatacaagccgtgccgtcagtctacgctaatggcaag
ctgcttcacgtaggtcgcggttctttaggagagcttttgcagaagctggaagaagccttc
ggcagtgctccgcaagaggacgaagcgccgatagagagagatttcgacgtgctggtattg
ggcggcggaccagccggagcttccgcagccatctactctgcacgcaagggcctacgggtg
gcgattgttgccgagcgcataggcggacaggtaaaagagacggtaggcatagaaaacctt
atctccgtgccgcagactactggtgcagaacttgccaacgcactccgcacacatatagag
cactatccgatagagattttcgaggagcgtaagatagagaaagtagagttgcagggaacg
gagaaaagtgtctccaccgtaggcggcgagatgttccatgcaccggcggtaatcattgcc
acaggggcaagctggcgcaaactgaatgtggagggcgaagcggaatacataggacgcggc
gtggcattctgtccgcattgcgacggtccgttctatcaaggcaagcatgtggcggttatc
ggtggaggtaactcggggattgaagctgccatcgacctggcaggcatctgccggaaggta
acggtattcgaatttgccgatacactgaaagccgaccaagtgctgcaagagaaagcccgg
agcctgccgaatgtggaaatcttcacctcgtcacaaaccgtcaaagtcgatggaaacagg
gaaaaagtaacttctatccgcatcaaagaccgccttaccggcgaggaacgagacttcccg
ttagacggcatcttcgtgcaaatcggtttggcagccaacagcgctcctttccgcgacaag
ctggaaacgactccggccggggagattaagattgacgctttctgccgtaccacacttccg
ggggtatatgcggcaggggatgtatcgaatgttccctacaagcagatagccattgccatg
ggcgaaggggcaaaggcagcactctcggcattcgatgaccgtatccgtggagtgatttag

DBGET integrated database retrieval system