KEGG   Burkholderia insecticola: BRPE64_ACDS00480Help
Entry
BRPE64_ACDS00480  CDS       T02684                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
buo  Burkholderia insecticola
Pathway
buo00970  Aminoacyl-tRNA biosynthesis
buo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BRPE64_ACDS00480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:buo03029]
    BRPE64_ACDS00480
Enzymes [BR:buo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BRPE64_ACDS00480
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BRPE64_ACDS00480
Mitochondrial biogenesis [BR:buo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BRPE64_ACDS00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY DUF3941
Motif
Other DBs
NCBI-ProteinID: BAN21802
UniProt: R4WV85
LinkDB All DBs
Position
1:53799..55274
Genome map
AA seq 491 aa AA seqDB search
MNMQWEVVIGLETHAQLSTVSKIFSGAPTQFGASPNSQASPVDLALPGVLPVMNRGAVER
AIRFGLSIGAHIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKE
AYSKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAK
ALHGLVMWLGICDGNMQEGSFRCDANVSVRPVGQQAFGTRAEIKNLNSFRFLEEAIQYEV
RRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIEPSWIERV
KGEMPELPADMQKRFVDTYGLTPYDAGVLTSSKAMASYFEALVQKAGAGQAKIAANWIMG
DVSAQLNRESLDIADSPVSAAQLALVIQRIADGTISNKIAKDIFQAIWDEKATDEGAADR
IIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPQ
QVNELLKKKLS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatgcagtgggaagtcgtcatcggtctggaaacgcacgcgcagttatccaccgtc
tccaagattttttcgggcgcgcccacgcagttcggcgcaagcccgaactcgcaggcaagc
cccgtcgatctcgcgctgcccggcgtgctgccggtgatgaaccgcggcgctgtcgagcgc
gcgattcgcttcggcttgtcgatcggtgcgcatatcgcgccgcgcagcatcttcgcgcgc
aagaactacttctatccggatctgccgaagggctatcagatcagccagtacgagattccg
gtcgtgcagggcgggcagatcaccatccaggttccggccaacgaaaaggcgggcaaggaa
gcgtattcgaagaccgtgaatctcacgcgtgcgcacctcgaagaggacgcgggcaagtcg
ctgcatgaagacttcgcgggcatgacgggcatcgacctgaaccgcgcgggcacgccgttg
ctcgaaatcgtcaccgagccggaaatgcgcagcgcggccgaagcggtcgcgtatgcgaag
gcgctgcatggcctcgtcatgtggctcggcatctgcgacggcaacatgcaggaaggctcg
ttccgctgcgacgccaacgtgtcggtgcggccggtcggccagcaggcgttcggcacgcgc
gccgagatcaagaacctgaactcgttccgcttcctcgaagaagcgattcaatacgaagtg
cgccgtcagatcgagctgatcgaagacggcggcacggtggttcaggaaacgcgtctgtac
gatccggacaagcgcgaaacccgctcgatgcgcagcaaggaagatgcgcacgattaccgc
tatttccccgatccggatctgatgccgctcgtgatcgaaccgtcctggatcgagcgcgtg
aagggcgagatgcccgagcttccggcggacatgcagaagcgtttcgtcgacacctacggc
ctcacgccgtatgacgcgggcgtgctgacttcgtcgaaggcgatggcatcgtacttcgaa
gcgctcgtgcagaaggccggcgcgggtcaggcgaagatcgccgcgaactggatcatgggc
gacgtctccgcgcaactgaaccgcgaatcgctcgatatcgctgattcgccggtgtcggcg
gcgcagctcgcgctggtcattcagcgcatcgccgacggcaccatctccaacaagatcgcg
aaggacatcttccaggcgatctgggacgagaaggcgacggacgaaggcgcggcggaccgc
atcatcgaggcgaaggggctcaagcagatttcggataccggcgcgctcgaagcgatcatc
gacgaagtgctcgccgccaatcagaaatcggtcgaggaattccgcgcgggcaaggagaag
gcgttcaacgcgctgatcggccaggcgatgaaggcgaccaagggcaaggccaatccgcag
caggtcaacgaactgctgaagaaaaagctatcctga

DBGET integrated database retrieval system