KEGG   Burkholderia insecticola: BRPE64_ACDS00670Help
Entry
BRPE64_ACDS00670  CDS       T02684                                 

Definition
(GenBank) glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buo  Burkholderia insecticola
Pathway
buo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRPE64_ACDS00670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buo02000]
    BRPE64_ACDS00670
Enzymes [BR:buo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRPE64_ACDS00670
Transporters [BR:buo02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRPE64_ACDS00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAN21821
UniProt: R4WSH4
LinkDB All DBs
Position
1:78609..79265
Genome map
AA seq 218 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEMRVPYRLEFVNIRAGAQNDPNFCRVNPMSKLPALEDGVVR
VAESGAVLLYLADRYPETGMGVPLDDPARGRFLQWMFFTGSCLEPAMAERMTGARGNTVS
FGWGDLSRVEHAIEGALEEGPWLLGEQFTAADILAASTLQIAFMAKLVGPQGVLFDYVER
ALAREGYERASAIDHREAERLALRPHAGVAHGTEESQS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaagacacgcgcctttcgcgcgctgtggatgctcgaagaa
atgcgcgtgccgtaccggctcgaattcgtgaatatccgcgcgggcgcgcagaacgatccg
aatttttgccgcgtcaatccgatgtcgaagttgcccgcgctggaggacggcgtggtgcgc
gtggccgagtcgggcgcagtgctgctctatcttgcagaccgctatccggaaaccggcatg
ggcgtgccgctcgacgatcccgcgcgcggccgctttctgcaatggatgtttttcaccggc
tcatgcctggaaccggcgatggccgagcgcatgaccggcgcgcgaggcaacacggtgagc
ttcggctggggcgatctctcgcgcgtcgagcacgcgatcgaaggcgcgctggaggaaggg
ccgtggctgctcggcgaacaattcaccgccgccgatattctcgcggcgagcacgttgcag
atcgcgttcatggcgaagctggtcgggccgcagggcgtgctgttcgattatgtcgagcgg
gcgctcgcgcgtgagggctacgagcgcgcgtccgcaatcgatcatcgtgaggcggagcgg
ctggcgctcaggccgcacgcgggtgtcgcgcacggcacggaagaatcgcaatcgtga

DBGET integrated database retrieval system