KEGG   Burkholderia insecticola: BRPE64_ACDS01710Help
Entry
BRPE64_ACDS01710  CDS       T02684                                 

Definition
(GenBank) penicillin-binding protein 6 Serine peptidase MEROPS family S11
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
buo  Burkholderia insecticola
Pathway
buo00550  Peptidoglycan biosynthesis
buo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BRPE64_ACDS01710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:buo01002]
    BRPE64_ACDS01710
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buo01011]
    BRPE64_ACDS01710
Enzymes [BR:buo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BRPE64_ACDS01710
Peptidases [BR:buo01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BRPE64_ACDS01710
Peptidoglycan biosynthesis and degradation proteins [BR:buo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BRPE64_ACDS01710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: BAN21925
UniProt: R4WM55
LinkDB All DBs
Position
1:173177..174568
Genome map
AA seq 463 aa AA seqDB search
MRVRLSNERCFAAAPRVPQSWRSARPERTVCLSNPCFADHPIPDPCRRSLLFPPIDPMRF
VPPGLTVSSVSTSTVHRRAFKAALALPAVLAAASAFAQVPPPDVTAHSWVLVDATSNQVL
ASGNADERVEPASLTKLMTAYLVFDALKSKKINMDQTVTPSEAVRRVRTDESRMFIEANK
PVTVHDLVYGMIIQSGNDAAIALAELVGGSEANFVTLMNAAAKRIGMKHTNFADVNGMPD
PQHYTTAGDLAVLSTHLIREFPEYYSIFSVRDFTYNKIKQPNRNRLLWLDPTVDGLKTGH
TKAAGYCLIATAQRSLASTPDAKRRLVAVMMGEPKEINRVQDALKMLNYGYSAYDSVRLY
KANQVIESPRVYKGATDNVQAGVSTDQYITVPKGMGDKVKPTVTKSDLLVAPIKKGQQIG
TVKMMADGKEVAQFPLVALQDVPEAGLFGRLWDSALLMWQKRK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtccgtctgtcgaacgagcgctgtttcgccgcggcgccgcgcgtgccgcagtca
tggcgcagcgcccgacccgagcggacggtctgcctgtccaacccgtgcttcgccgatcat
ccgatccccgatccctgtcgtcgcagcctgctttttccgccgatcgatcctatgcgcttt
gtccctcccggcctgaccgtttcttccgtatccacttccaccgttcatcgccgcgccttc
aaggccgccctcgcgctgcccgccgttctggccgccgcgagcgcgttcgcgcaagttccg
ccgcccgatgtgacggcgcattcgtgggtgctcgtcgatgccacgagcaatcaggtgctc
gcatcgggcaatgccgatgagcgcgtcgagccggcatcgctcacgaagctgatgaccgcg
tatctcgtcttcgacgcgctgaagtccaagaagatcaacatggaccagaccgtcacgccg
agcgaggccgtgcgccgcgtgcgcacggacgaatcgcgcatgttcatcgaggcgaacaag
ccggtcaccgtgcacgatctcgtctacggcatgatcatccagtcgggcaacgacgcggct
atcgcgctggcggaactcgtcggcggcagcgaagccaacttcgtcacgctgatgaacgcg
gcggcgaagcgcatcggcatgaagcacaccaatttcgccgatgtaaacggcatgcccgat
ccgcagcactacacgaccgccggcgacctggccgtgctgtcgacgcacctgatccgcgaa
ttccccgagtactacagcatcttctcggtgcgggacttcacgtacaacaagatcaagcag
ccgaaccgtaaccgcctgctgtggctcgatccgaccgtcgacggcctgaagaccggccac
acgaaggccgccggctactgcctgatcgcgacggcacagcgttcgcttgcgagcacgccg
gatgccaaacgccgtctcgtcgccgtgatgatgggcgaaccgaaagagatcaatcgcgtg
caggacgccctgaagatgctgaactacggctattcggcatatgactcggtgcgtctctac
aaggcgaatcaggtgatcgagtcgccgcgcgtgtacaagggcgcgaccgacaacgtgcag
gccggcgtgtcgaccgaccagtacatcaccgtgccgaagggcatgggcgacaaggtcaag
ccgacggtcacgaaatccgacctgctcgtcgcgccgatcaagaagggccagcagatcggc
accgtcaagatgatggcggacggcaaggaagtcgcgcagttcccgctggtcgcgctgcag
gacgtgccggaagccggtctgttcggccgcctgtgggactcggcgctgctgatgtggcaa
aagcgtaagtaa

DBGET integrated database retrieval system