KEGG   Burkholderia insecticola: BRPE64_ACDS02380Help
Entry
BRPE64_ACDS02380  CDS       T02684                                 

Definition
(GenBank) ferredoxin
Organism
buo  Burkholderia insecticola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_10 Fer4_21 Fer4_4 GF_recep_IV Fer4_17 Fer4_6
Motif
Other DBs
NCBI-ProteinID: BAN21992
UniProt: R4WVR0
LinkDB All DBs
Position
1:236529..236780
Genome map
AA seq 83 aa AA seqDB search
MIITDECINCDVCEPECPNDAISMGPEIYVIDPNKCTECVGHFDEPQCQQVCPVECIPRD
PAHVETPEQLLTKYHALMAAKGE
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
ttgatcattaccgacgagtgcatcaactgcgacgtatgcgagcccgagtgcccgaacgac
gccatttcaatgggtcccgagatctacgtgatcgacccgaacaaatgcacggaatgcgtc
ggccatttcgatgagccgcagtgccagcaagtgtgccccgtcgagtgcattccacgcgat
ccggcgcacgtcgaaacgccggagcagttgctgaccaagtatcacgcgctgatggcggcg
aagggcgagtaa

DBGET integrated database retrieval system