KEGG   Burkholderia insecticola: BRPE64_ACDS03360
Entry
BRPE64_ACDS03360  CDS       T02684                                 

Definition
(GenBank) type VI secretion system effector Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
buo  Burkholderia insecticola
Pathway
buo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BRPE64_ACDS03360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buo02044]
    BRPE64_ACDS03360
Secretion system [BR:buo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BRPE64_ACDS03360
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: BAN22090
UniProt: R4WMJ1
LinkDB
Position
1:339157..339642
AA seq 161 aa
MAQDIFLKIDGITGESLDDKHKDEIEVLNWNWEIRQESTMHSGSGGGAGKASVSDLVFEH
NIDRSSPNLMKYALTGKHIDAATLVMRKAGGSPLEYLKITMHDVLVTRVAPSGSRNDSDK
SRESVSLSFSKVKQEYVVQNAQGGSGGAVTAGFDIKGNKEA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcacaggacattttcttgaagatcgacggtattaccggcgagtcgctggacgacaag
cacaaggacgaaatcgaagtcctgaactggaactgggaaatccgccaggaatccacgatg
cactcgggtagcggcggcggtgcgggcaaggcatcggtgtcggacctcgtgttcgaacac
aacatcgatcgttcgagccccaacctgatgaagtacgccctgaccggcaagcacatcgat
gcggcaacgctggtgatgcgcaaggctggcggtagcccgctggaatacctgaagatcacg
atgcacgacgtgctcgtgacgcgcgtggcgccgtcgggcagccgtaacgatagcgacaag
agccgcgaaagcgtctcgctgtcgttctcgaaggtcaagcaggaatacgtcgtccagaac
gcccagggcggttcgggcggtgcggtgacggctggctttgacatcaagggcaacaaggaa
gcgtaa

DBGET integrated database retrieval system