KEGG   Burkholderia insecticola: BRPE64_ACDS07750Help
Entry
BRPE64_ACDS07750  CDS       T02684                                 

Definition
(GenBank) 2-aminoethylphosphonate--pyruvate transaminase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
buo  Burkholderia insecticola
Pathway
buo00440  Phosphonate and phosphinate metabolism
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BRPE64_ACDS07750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buo01007]
    BRPE64_ACDS07750
Enzymes [BR:buo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BRPE64_ACDS07750
Amino acid related enzymes [BR:buo01007]
 Aminotransferase (transaminase)
  Class V
   BRPE64_ACDS07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP SHMT
Motif
Other DBs
NCBI-ProteinID: BAN22529
UniProt: R4WFX8
LinkDB All DBs
Position
1:823748..824812
Genome map
AA seq 354 aa AA seqDB search
MLLLNPGPVTLSERVRKSLLQTDLCHREPEFFDLQDEARRRLVAAYELDPAKWSAVLMTG
SGTAAVESMIAGLVPEGGRLLVVENGVYGDRVAQIAQQYGIEYEVAKYEWMQAPDIDAIV
RLLDTKKFTNVAIIHHETTTGRLNAIDALSRACAQRGVGLLLDAVSSFGAEAIDFDGGGI
AAIAATANKCLHGVPGAAFVIARRDALAQAASRNYYLGIARLAKLQDARNTPFTPSVHAY
YALVEALREFEEEGGWRARHARYAKLAEQVRAGLAALGMESALPPEESSVVLRAYRLPAG
VTYETLHDALKAKGFVIYAGQGGLSKELFRISTMGALDANDMDRLISSFVELLR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctcaatccgggtcctgtcacgctgagcgaacgcgtgcgcaagagcctgctg
caaaccgacttgtgccatcgcgagccggagttcttcgatcttcaggacgaggcgcgccgc
cgtctcgtcgcggcttacgaactcgatccggccaagtggagcgccgtgctcatgaccggc
tcgggcacggcggccgtcgagagcatgatcgccgggctcgtgccggaaggcgggcggctg
ctggtcgtggagaacggcgtgtacggcgaccgtgtcgcgcagatcgcgcagcagtacggc
atcgagtatgaagtcgcgaagtacgagtggatgcaggcgccggatatcgacgccatcgtc
aggctgctcgacaccaagaagttcacgaacgtcgcgatcatccatcacgaaaccaccacg
gggcgtctgaacgccatcgacgcactgtcgcgcgcctgcgcgcagcgtggcgtgggcctt
ctgctcgacgcggtgagcagcttcggcgccgaagcgatcgatttcgacggcggcggcatc
gccgcgatcgccgcgacggccaacaagtgcctgcacggcgtgccgggcgcggcgttcgtg
atcgcgcggcgcgacgcgctggcgcaggctgcgagccgcaactattacctcggcatcgcg
cgtctcgcgaagttgcaggacgcgcgcaacacgccgttcacgccgtcggtgcatgcgtat
tacgcgctcgtcgaggcgctgcgcgagttcgaggaagaaggcggctggcgcgcgcgtcac
gcgcgttacgcgaagctcgcggagcaagtgcgcgcgggtctggccgcgctcggcatggag
agcgcgttgccgccggaggaatcgtcggtggtattgcgggcgtaccggctgccggcgggc
gtcacctacgagacgctgcacgacgcgctgaaggccaagggcttcgtgatttacgcgggg
cagggcggtttgtcgaaggaactgttccgcatctcgacgatgggcgcgctcgatgcgaac
gacatggatcgcctgatttcgtcgttcgtggaattgctgcgctga

DBGET integrated database retrieval system