KEGG   Burkholderia insecticola: BRPE64_ACDS11020Help
Entry
BRPE64_ACDS11020  CDS       T02684                                 

Definition
(GenBank) UPF0761 membrane protein BC1002_2016
  KO
K07058  membrane protein
Organism
buo  Burkholderia insecticola
Brite
KEGG Orthology (KO) [BR:buo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BRPE64_ACDS11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAN22856
UniProt: R4WVA8
LinkDB All DBs
Position
1:1156798..1158111
Genome map
AA seq 437 aa AA seqDB search
MRLQYISIDLAAVRRLAGFVARRIGEDRVAQVAGSLTFTSVLSLVPLATVAFALFTAFPI
FGSFQASLQDFLAVHLMPPQINDQIFKYLNQFASKAKGLTTVGMIILFVTSVMTMMTVES
AFNVIWRVRKARPFAQRVLVYWSIITLGPILFGCSLSISSYVFAHSVAFAGSHNLMPPIV
EWALTGVSLPLTVLAFTFIYVYMPNCKVEWRDALVGGLIAAVAFELGKRGFGLYIRRIPT
YTAVYGAFAALPVFLLWVYLCWMIALVGAMVTSALPAIRTGQYHRRDFPGSDLLDTLEIL
ARLVEARDEGKPGYTALHLSTMARCDLDTSTRLIARLDALGWIGRLEDSRTPRYVLIANP
NQMTVNMLFEQFVIDRAELEYQLKLDVAQVDCAALMEALDNEKLEITLGSLIAARASALT
HARLREARPSSMPPQTA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgcagtacatttccatcgatctcgcggccgtccggcgcctggccggcttcgtc
gcgcggcgcatcggcgaggaccgcgtcgcgcaagtggccggcagtctcacgtttaccagc
gtgctgtcgctcgtgccgctcgcgaccgtggcgttcgcgctcttcacggcgtttccgatc
ttcggctcgtttcaggcgtcgttgcaggactttctcgcggtgcacctgatgccgccgcag
atcaacgaccagatcttcaagtatctgaaccagttcgcctcaaaggcgaaggggctcacg
accgtgggcatgatcatcctgttcgtgacctccgtcatgacgatgatgaccgtcgagtcc
gcgttcaacgtgatctggcgggtgcgtaaagcgcgcccgttcgcgcagcgcgtgctcgtc
tactggtcgatcatcacgctcgggcccattctgttcggctgcagcctgtcgatttcgtcc
tacgtgtttgcgcattccgtcgcgttcgcgggctcgcacaacctgatgccgccgatcgtc
gaatgggcgctgacgggcgtgtcgttgccgctgaccgtgctcgccttcacgtttatctac
gtgtatatgccgaactgcaaggtcgaatggcgggatgcgctggtcggcggcctgatcgcg
gcggtcgcgttcgaactcggcaagcgtggcttcggcctttacattcgccgcattcccacc
tacacggcggtgtacggcgcgttcgccgcgctgccggtgttcctgctgtgggtgtatttg
tgctggatgattgcgctggtcggcgcaatggtgacttcggcgctgcccgcgatccgcacg
gggcagtatcatcggcgcgattttccgggcagcgacctgctcgacacgctcgaaattctc
gcgcggctcgtcgaggcgcgcgacgaaggcaagcccggctacacggcgttgcatctctcg
acgatggcccgctgcgatctcgatacctccacgcgtctgatcgcacggctcgacgcgctc
ggctggatcggtcggctggaagattcgcgcacgccgcgctatgtgctgattgccaatccg
aatcagatgacggtgaatatgttgttcgagcaattcgtaatcgaccgcgccgagctggag
tatcagttgaagctcgacgtcgcgcaggtcgattgcgccgcgttgatggaggcgctcgat
aacgagaaactcgaaatcacgctcggttcgctgatcgcggcgcgggcgtcggcgctgacg
catgcgcgtctgcgcgaggcgcggccctcgtcgatgccgccgcagacggcctga

DBGET integrated database retrieval system