KEGG   Burkholderia insecticola: BRPE64_ACDS16660Help
Entry
BRPE64_ACDS16660  CDS       T02684                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
buo  Burkholderia insecticola
Pathway
buo00020  Citrate cycle (TCA cycle)
buo00310  Lysine degradation
buo00380  Tryptophan metabolism
buo01100  Metabolic pathways
buo01110  Biosynthesis of secondary metabolites
buo01120  Microbial metabolism in diverse environments
buo01130  Biosynthesis of antibiotics
buo01200  Carbon metabolism
Module
buo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRPE64_ACDS16660 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BRPE64_ACDS16660 (sucA)
   00380 Tryptophan metabolism
    BRPE64_ACDS16660 (sucA)
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BRPE64_ACDS16660 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: BAN23420
UniProt: R4WR68
LinkDB All DBs
Position
1:complement(1738934..1741792)
Genome map
AA seq 952 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEELYEQYLDNPASVPETWRAYFDALQNVPASDGTAHNDVAH
GPIVESFAQRAKANAFLPRESTGDLTTARKQVYVQSLIGAYRFLGTQWANLDPLKRRERP
AIPELEPGFYDFTEADMDQVFNANNLYFGFEQASLRDIVKALRDTYCGTIGAEFMYISDP
EQKRWWKEKLESIRSTPNFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGESFI
ASMDEVVRHAGANGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGDVK
YHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEEGLQVLPVQIHG
DAAFAGQGVVMETLNLAQTRGYGTYGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKMIE
APVLHVNGDDPEAVVLATQLAIEFRMKFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMYKT
IAKHPGTRALYAEKLVQQGVITAEDADNYVKAYRQAMDEGHHTIDPVLSNYKSKYAVDWV
PFLNRKWTDAADTAVPLAELKRLAERVTTIPENFKLHPLVERVINDRRAMGRGDAKLDWG
MGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYIPLQNIAEGQA
KFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKWGR
VSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQMFHLLRRQMIRLFR
KPLIIFTPKSLLRHKEAVSDLSELAKGSFQPVIGEVDEAIEAKKVKRVIACSGRVYYDLV
AHRREAKSNDVAIVRIEQLYPFAHKQFDAEIKRFENATEVVWVQDEPQNQGAWFYVEHHL
REGMREGMKLAYSGRPASASPAVGYYAKHYEQQKALVEGSFGRLKGAQVIAK
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatttgttcggcggtaatgctccgtacgtcgaa
gagttgtacgagcaatatctcgataatcccgcgtcagtgcccgagacctggcgagcctat
ttcgacgcgttgcagaacgtgcccgcatccgacggcacggctcacaacgacgtggcccac
ggccccatcgtcgaatcgtttgcccagcgcgcgaaggccaatgccttcctccctcgcgaa
agcaccggcgacctgacgaccgcgcgcaagcaggtctacgttcagtcgctgatcggcgca
tatcgcttcctcggcacgcaatgggccaatctcgatccgctcaagcggcgcgagcgtccc
gccatccccgagctcgaacccggtttctacgacttcaccgaagccgacatggaccaggtg
ttcaacgcgaacaacctgtatttcggcttcgagcaggcgtcgctgcgcgacatcgtcaag
gcgctgcgcgacacgtactgcggcacgatcggcgctgagttcatgtacatcagcgatccc
gaacagaagcgctggtggaaggagaagctcgaatcgatccgctcgacgccgaacttctcg
aacgaaaagaaaaagcacatcctgaatcgcctgacggccgccgaaggcctcgagcgtttc
ctgcatacgaagtacgtcggtcagaagcgtttctcgctggaaggcggcgagagcttcatc
gcgtcgatggacgaggtcgtccgtcacgcgggcgcgaacggcgtgcaggaaatcgtcatc
ggcatggctcaccgcgggcgtctcaacgtgctggtcaacacgctcggcaaaatgccggcg
gacctgttcgccgaattcgaaggcaagcacgtcgatgacctgccggccggcgacgtgaaa
taccacaagggcttctcgtcggacgtctcgaccgaaggcggcccggttcacctgtcgctc
gcattcaacccgtcgcaccttgaaatcgtgaatccggtggtcgaaggctcggccaaggcg
cgtatggatcgtcgcggcgacgaagaaggcctgcaagtgctgccggtgcagatccacggc
gacgccgccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcgcagacgcgc
ggctacggcacgtacggcacgctgcatatcgtcatcaacaaccagatcggtttcactacg
tcggatccgcgcgactcgcgctcgacgctgtactgctcggacgtcgtcaagatgatcgag
gcgccggtgctgcacgtgaacggcgacgatcccgaggccgtcgtgctcgccacgcagctc
gcgatcgagttccgcatgaagttccacaaggacgtggttgtcgacatcgtctgcttccgc
aagcttggtcacaacgagcaggacacgccggcggtcacgcagccgctgatgtacaagacc
atcgcgaagcatccgggcacgcgcgcgctgtacgcggaaaagctggtgcagcaaggcgtg
atcaccgccgaagacgctgacaactacgtcaaggcgtatcgtcaggcgatggacgaaggt
caccacacgatcgatccggtgctctcgaactacaagagcaagtacgcggtcgactgggtg
ccgttcctgaaccgcaagtggaccgacgccgccgacaccgccgtgccgctcgcggaactg
aagcgtctcgccgagcgcgtcacgaccattccggaaaacttcaagctgcatccgctggtc
gagcgcgtcatcaacgaccgccgcgcaatgggccgtggcgatgcgaagctcgactggggc
atgggcgagcacctcgcgttcgcatcgctggtggcatcgggttatgcggttcgtctgacg
ggtcaggactcgggccgcggcacgttcacgcaccgccacgcggtgctgcacgatcagaac
cgcgagcgctggaacgacggcacctacattccgctgcaaaacatcgcggaaggtcaggcc
aagttcacggtgatcgactccgtgctgtccgaagaagcagtgctcggtttcgagtacggt
tattcgacggccgagccgaatacgttcgtcgcatgggaagcgcagttcggcgacttcgta
aacggcgcgcaagtcgtgatcgatcagttcatctcgtcgggcgaagtgaagtggggccgc
gtctcgggtctcaccatgctgctgccgcacggctatgaaggccagggtccggagcactcg
tcggcacgtatcgagcgcttcctgcaactctgcgcggatcacaacatgcaagtggtccag
ccgacgacgccggctcagatgttccatctgctgcgccgtcagatgatccgcttgttccgc
aagccgctcatcatcttcacgccgaagtcgctgctgcgtcacaaggaagcggtgtccgat
ctgtcggaactggcgaagggctcgttccagccggtcatcggcgaagtggacgaagcgatc
gaagcgaagaaggtcaagcgcgtgatcgcgtgttcgggccgcgtgtattacgacctcgtc
gcgcatcgccgcgaagcgaagagcaacgacgtcgcgatcgtgcgtatcgagcagctgtat
ccgttcgcgcacaagcagttcgacgcggaaatcaagcgcttcgaaaacgcgaccgaagtg
gtctgggtgcaggacgagccgcagaaccagggcgcctggttctacgtcgagcaccatctg
cgtgaaggcatgcgcgaaggcatgaagctggcctacagcggccgtcccgcttcggcttcg
cccgcggtcggctactacgcgaagcactacgagcagcagaaggcgctcgtggaaggctcg
ttcggccgcctgaagggcgcgcaggtcatcgcgaagtaa

DBGET integrated database retrieval system