KEGG   Burkholderia insecticola: BRPE64_ACDS25870Help
Entry
BRPE64_ACDS25870  CDS       T02684                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
buo  Burkholderia insecticola
Brite
KEGG Orthology (KO) [BR:buo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:buo03012]
    BRPE64_ACDS25870
   03029 Mitochondrial biogenesis [BR:buo03029]
    BRPE64_ACDS25870
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buo04147]
    BRPE64_ACDS25870
Translation factors [BR:buo03012]
 Eukaryotic Type
  Elongation factors
   BRPE64_ACDS25870
 Prokaryotic Type
   BRPE64_ACDS25870
Mitochondrial biogenesis [BR:buo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BRPE64_ACDS25870
Exosome [BR:buo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRPE64_ACDS25870
  Exosomal proteins of breast cancer cells
   BRPE64_ACDS25870
  Exosomal proteins of colorectal cancer cells
   BRPE64_ACDS25870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: BAN24341
UniProt: R4WTP9
LinkDB All DBs
Position
1:complement(2680128..2681318)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDTGELGEVAIMNLADALDTYIPTPERAVDGSFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEIEIVGIKTTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcggaccaagccgcacgtgaacgtgggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcaatcacgacggtgctgaccaagaagttc
ggcggcgaagcgaaggcatacgaccagatcgatgcagcgccggaagaaaaggcacgtggt
attaccatcaacaccgcgcacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgcagcgcagatggac
ggcgcaatcctggtgtgttcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcccgtcaggttggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgagctgctcgaactcgtcgaaatggaagtgcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggccaagctcgcgctggaa
ggcgacacgggtgaactgggcgaagtggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgcgctgtggacggttcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtagtgacgggtcgtatcgagcgcggtgtggtgaag
gttggcgaggaaatcgaaatcgtcggtatcaagacgacggtgaagaccacttgcacgggc
gtggaaatgttccgcaagctgctcgaccaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggccaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtcaagctgatcgccccgatcgccatggaagaaggtctgcgtttcgcaatccgt
gaaggcggtcgtaccgtcggcgctggtgtcgtcgcgaagattatcgagtaa

DBGET integrated database retrieval system