KEGG   Burkholderia sp. RPE64: BRPE64_BCDS01400Help
Entry
BRPE64_BCDS01400  CDS       T02684                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00630  Glyoxylate and dicarboxylate metabolism
buo00710  Carbon fixation in photosynthetic organisms
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
buo01200  Carbon metabolism
Module
buo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_BCDS01400
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRPE64_BCDS01400
Enzymes [BR:buo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRPE64_BCDS01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAN24801
UniProt: R4WZC3
LinkDB All DBs
Position
2:142574..144211
Genome map
AA seq 545 aa AA seqDB search
MPAQVNREFLSLPPVLTLQSQQPQHISATLASAHRGARLFHRHCRGNGMNDFSKAAVEAA
RNPSDPRSRYAAGVMKYREMGYWQPDYIPKDTDVIALFRITPQAGVEPEEAAAAVAGESS
TATWTVVWTDRLTACDMYRAKAYRCEPVPNSRADEPQYFAYIAYELDLFEEGSVANLTAS
IIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDKYGRPLLGATVKPKLG
LSGKNYGRVVYEGLKGGLDFLKDDENINSQAFMHWRDRYLFAMEAVNRAQAETGEVKGHY
LNVTAGTMEDIYERAEFAKELGSCIVMIDLVIGWTAIQSMSKWARKNDMILHLHRAGHGT
YTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLSVQGYYNVLREARNEVDLSR
GIFFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFGGGTIGHPQGIQAGATAN
RVALEAMVKARNEGRDIANEGPDILEAAARSCTPLKQALDTWRDVTFNYASTDTPDFAVT
ATASA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacaagttaatcgtgaattcctttcgctgccgccagtgcttactctgcaatca
cagcagccgcagcacatcagcgcgacgctcgcttctgcacatcggggcgcacgtctcttt
catcgtcactgtcgaggaaacggaatgaacgacttcagcaaggccgccgtcgaggcggcg
cgcaacccgtccgatccgcgctcgcgctatgcggccggcgtcatgaagtatcgcgagatg
ggctactggcagcccgactacataccgaaggatacggacgtgatcgcgctgtttcgcatc
acgccgcaagcaggcgtcgaaccggaagaggccgctgcggccgtggcaggcgaatcgtcg
acggcgacgtggaccgttgtgtggaccgatcgcctcaccgcttgcgacatgtaccgcgcg
aaggcgtatcgctgcgagccggtgccgaactcacgcgccgacgagccgcagtacttcgcg
tacatcgcctacgaactcgatctgttcgaggaaggatcggttgcgaacctgacggcgtcg
atcatcggcaacgtgttcggcttcaaaccgctgaaggcgcttcgtctcgaagacatgcgc
attcccgtcgcttatctgaagacgtttcaaggaccgccgacgggcatcgtcgtggagcgc
gaacggctcgacaagtacggtcgcccgctgctcggcgcgaccgtgaagccgaagctcggc
ttgtcggggaagaactatgggcgcgtcgtgtacgaaggcctcaaaggcggactcgacttc
ctgaaggacgacgagaacatcaattcgcaagcgttcatgcattggcgcgaccgctatctc
ttcgcgatggaagccgtgaaccgcgcgcaggccgaaacgggcgaagtgaaaggccactat
ctcaacgtaaccgccggcacgatggaggacatctacgagcgcgccgaattcgcgaaggaa
ctgggctcgtgcatcgtgatgatcgatctcgtgatcggctggaccgcgattcagtcgatg
tcgaagtgggcgcgcaagaacgacatgatcctgcacttgcatcgcgcggggcacggcact
tatacgcggcagcgcaatcacggcatctcgtttcgcgtgatcgcgaagtggctgcgcatg
gcgggcgtggatcacgcgcatgcaggcacggcggtgggcaagctcgaaggcgatccgctt
tcggtgcagggctattacaacgtgttgcgcgaggcacgcaacgaagtggatctgtcgcgc
ggcatcttcttcgatcaaccgtgggcgggcctgcgcaaagtgatgccggtggcctcgggc
ggcattcatgcggggcagatgcatcagctgctcgatctcttcggcgacgatgcgatcctg
caatttggcggcggcacgatcggacatccgcaaggcattcaggcgggcgcaacggccaat
cgcgtcgcactcgaagcgatggtgaaagcgcgcaacgaagggcgtgatatcgcgaacgaa
ggccccgatattctcgaagccgcagcgcgttcgtgcacgccgctcaagcaggcgctcgac
acttggcgcgatgtgaccttcaactatgcatcgacggatacgccggatttcgcggtgacg
gcaactgcatcggcctga

DBGET integrated database retrieval system