KEGG   Burkholderia sp. RPE64: BRPE64_BCDS01410Help
Entry
BRPE64_BCDS01410  CDS       T02684                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
buo  Burkholderia sp. RPE64
Pathway
buo00630  Glyoxylate and dicarboxylate metabolism
buo00710  Carbon fixation in photosynthetic organisms
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
buo01200  Carbon metabolism
Module
buo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_BCDS01410
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRPE64_BCDS01410
Enzymes [BR:buo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRPE64_BCDS01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAN24802
UniProt: R4X177
LinkDB All DBs
Position
2:144261..144677
Genome map
AA seq 138 aa AA seqDB search
MKITQGTFSFLPPLTDEDISAQINYALDQGWACSVEFTDDPHPRNTYWDMWGMPMFDLHD
AAGVLMEVNACRKTYPHHYIKVNAFDSLRGFETMRMSFIVNRPEEEKGFRLERQDGQGRV
QHYAIRTYATDRPGGERY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacgcaaggcacgttttcattcctgcctcctctgaccgatgaggatatctcc
gcgcagatcaactatgcgctggatcagggctgggcctgttcagtcgaattcaccgacgat
ccgcacccgcgcaatacctactgggacatgtggggcatgccgatgttcgatctccacgat
gccgccggcgtgctgatggaggtgaacgcctgccgcaagacctatccgcatcattacatc
aaggtcaatgcgttcgactcgttgcgcggcttcgaaacgatgcgtatgtctttcatcgtg
aatcggccggaagaagaaaagggcttccgtctcgaacgtcaggacggtcagggccgcgtg
cagcattacgcgatccgtacttacgcaaccgaccgcccgggcggcgaacgctactga

DBGET integrated database retrieval system