KEGG   Burkholderia insecticola: BRPE64_BCDS01410Help
Entry
BRPE64_BCDS01410  CDS       T02684                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
buo  Burkholderia insecticola
Pathway
buo00630  Glyoxylate and dicarboxylate metabolism
buo00710  Carbon fixation in photosynthetic organisms
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
buo01200  Carbon metabolism
Module
buo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE64_BCDS01410
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRPE64_BCDS01410
Enzymes [BR:buo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRPE64_BCDS01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAN24802
UniProt: R4X177
LinkDB All DBs
Position
2:144261..144677
Genome map
AA seq 138 aa AA seqDB search
MKITQGTFSFLPPLTDEDISAQINYALDQGWACSVEFTDDPHPRNTYWDMWGMPMFDLHD
AAGVLMEVNACRKTYPHHYIKVNAFDSLRGFETMRMSFIVNRPEEEKGFRLERQDGQGRV
QHYAIRTYATDRPGGERY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacgcaaggcacgttttcattcctgcctcctctgaccgatgaggatatctcc
gcgcagatcaactatgcgctggatcagggctgggcctgttcagtcgaattcaccgacgat
ccgcacccgcgcaatacctactgggacatgtggggcatgccgatgttcgatctccacgat
gccgccggcgtgctgatggaggtgaacgcctgccgcaagacctatccgcatcattacatc
aaggtcaatgcgttcgactcgttgcgcggcttcgaaacgatgcgtatgtctttcatcgtg
aatcggccggaagaagaaaagggcttccgtctcgaacgtcaggacggtcagggccgcgtg
cagcattacgcgatccgtacttacgcaaccgaccgcccgggcggcgaacgctactga

DBGET integrated database retrieval system