KEGG   Burkholderia insecticola: BRPE64_BCDS03020Help
Entry
BRPE64_BCDS03020  CDS       T02684                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
buo  Burkholderia insecticola
Pathway
buo00250  Alanine, aspartate and glutamate metabolism
buo00410  beta-Alanine metabolism
buo00640  Propanoate metabolism
buo00650  Butanoate metabolism
buo01100  Metabolic pathways
buo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BRPE64_BCDS03020
   00650 Butanoate metabolism
    BRPE64_BCDS03020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRPE64_BCDS03020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRPE64_BCDS03020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buo01007]
    BRPE64_BCDS03020
Enzymes [BR:buo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BRPE64_BCDS03020
Amino acid related enzymes [BR:buo01007]
 Aminotransferase (transaminase)
  Class III
   BRPE64_BCDS03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 TERF2_RBM
Motif
Other DBs
NCBI-ProteinID: BAN24963
UniProt: R4WK95
LinkDB All DBs
Position
2:complement(298504..299796)
Genome map
AA seq 430 aa AA seqDB search
MSTLKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVCNTGHR
HPKIVEAIRAQLDCFTHTAYQIVPYESYVSLAEKISARAPGSHAKKTAFFTTGAEAVENA
VKIARAATGRPGVIAFTGGFHGRTLMGMALTGKVAPYKIGFGPFPSDVFHAPFPNALHGV
SVEDSLRAIEHLFKADIEAARVAAIIFEPVQGEGGFNQAPVEFVRGLRKICDEHGILLIA
DEVQTGFARTGKLFAMEHYGVVPDLMTIAKSLAGGMPLSGVVGRAEIMDAAAPGGLGGTY
AGNPLAVAAAHAVLDIIDDEKLCARGTALGDKLKAKLEALKADVPQIADVRGPGAMIAVE
FCKPGSHDADAAFAKLVQTRALERGLLLLVCGVYSNVVRFLFPLTIQNEIFDEALAILED
VLTETVGVTV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccctcaagaacgccgatctgcaagcccgcaagaatgccgcgaccccgcgcggc
gtcggcgtgatgtgcgacttctacgcggcgcgcgccgagaacgcggaattgtgggatgtc
gagggacgccgcttcatcgacttcgcggcgggtatcgcggtgtgcaacacggggcatcgt
catccgaagatcgtcgaggcgatccgcgcgcagctcgactgtttcacgcacaccgcgtat
cagatcgtgccgtacgagtcgtacgtctcgctcgcggaaaagatcagcgcccgcgcgccg
ggctcgcacgccaaaaagaccgcatttttcacgacgggcgcggaagccgtcgaaaacgcg
gtgaagatcgcgcgcgccgcgaccggccgtccgggcgtcatcgcctttacgggcggcttt
cacggccgcacgttgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggc
ttcgggccgttcccgtcggacgtgttccacgcgccgttcccgaatgcgctgcacggcgtg
tcggtggaagactcgctgcgcgccatcgagcatctgttcaaggcggatatcgaggcagcg
cgcgttgccgcgatcatcttcgaaccggttcagggcgaaggcggcttcaatcaggcgccg
gtggaattcgtgcgtggcctgcgcaaaatctgcgacgagcacggcatcctgctcatcgcc
gatgaagtgcagaccggcttcgcgcgcaccggcaagctgttcgcaatggagcactacggc
gtcgtgcccgatttgatgacgatcgcgaagtcgctggcgggcggcatgccgctgtcgggc
gtcgtcgggcgcgcggaaatcatggatgcggccgcgcccggcgggctcggcggcacgtat
gcgggcaacccgctcgcggtggcggcggcgcacgcggtgctcgacatcatcgacgacgaa
aaactctgcgcgcgaggtacggcgctcggcgacaagctcaaggcaaaactcgaagcactc
aaggccgacgtaccgcagatcgccgatgtgcgcggccccggcgcgatgatcgccgtcgag
ttctgcaagcccggctcgcacgacgccgacgcggccttcgccaagctcgtgcagacgcgc
gcgctggagcgcggtttgctgctgctcgtgtgcggcgtttattcgaacgtcgtccggttc
ctgtttccgctcaccattcaaaacgaaattttcgacgaggcgctcgccattctcgaagac
gtgctgacggaaacggtcggcgtcacggtttga

DBGET integrated database retrieval system