KEGG   Burkholderia insecticola: BRPE64_BCDS10090Help
Entry
BRPE64_BCDS10090  CDS       T02684                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buo  Burkholderia insecticola
Brite
KEGG Orthology (KO) [BR:buo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BRPE64_BCDS10090 (ahpF)
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BRPE64_BCDS10090 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Thi4 AlaDh_PNT_C FAD_binding_3 HI0933_like Glutaredoxin DAO K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAN25670
UniProt: R4WX35
LinkDB All DBs
Position
2:1008106..1009692
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLKAYLEKVTRPIELVAFLDDGDKSRELKSLLDEIASLSTRISVVEKEDAAA
RRPSFTIGEPGKPAGIHFAGIPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRNLDGDYA
FETYFSLSCQNCPEVVQALNVMAIINPRIKHVAIDGALFQAEVEAREVMAVPTMFLNGAA
FGSGRSGVKEILAKLDSGSAERAAKELENKPVFDVLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKSYEVDVMDVQRADKLVPGRVNE
IHLANGAVLKAKTVILSTGARWREINVPGEREYRGRGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVSAVTLIEFGTELRADAVLQKKLKSMPNVTIVTNAQTTEISGDGKKV
DGLTYTDRATGASHRVALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSLPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRASVEDEAVVEEEVTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctcaagaatcagttaaaagcctatctggaaaaggtcacccggccg
atcgaactcgtcgccttcctcgacgacggcgacaagtcgcgcgagctgaaaagcctgctc
gacgaaatcgcctcgctgtccacgcggatcagcgtcgtcgagaaagaggacgctgccgcg
cgccgtccgtcgttcaccatcggcgagccgggcaagcccgcgggcatccatttcgccggc
attccgatgggccacgaattcacgtcgctcgtgctggcgctgctgcagaccggcggccat
ccgatcaagctcgacgacgccaccatcgaacaaatccgtaatctcgacggcgactacgcc
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgatcatcaatccgcgcatcaaacacgttgcgatcgacggcgcgctgtttcag
gcggaagtcgaagcgcgcgaagtgatggccgtgccgacgatgttcctcaacggcgcagca
ttcggctcgggccgcagcggcgtgaaagaaattctggcgaagctcgattcgggttcggcc
gagcgcgccgcgaaggaactggaaaacaagccggtgttcgacgtgctgatcgtcggcggc
ggaccggcgggcgcggcagcggcgatctacgcggcgcgcaagggcattgcgaccggcgtc
gtcgcggaacgcttcggcggccaggtgctcgacacgatggcgatcgaaaacttcgtctcc
gtgcaggaaaccgaaggaccgaagttcgcgaccgcgctggagcagcacgtcaagagctat
gaagtcgacgtaatggacgtgcagcgcgccgacaagctcgtgccgggacgcgtaaacgag
attcatctcgcgaacggcgcggtgctgaaggcgaagaccgtgattctctcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgtgagtatcgcggccgcggcgttgcgtat
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcatcggcggcggc
aattcgggcgtggaagccgccatcgatctcgccggcatcgtctcggcggtcacgctgatc
gaattcggcaccgagttgcgcgccgacgcagtgctgcagaagaagctgaagagcatgccg
aacgtgacgatcgtcacgaacgcgcagaccaccgaaatttccggcgacggcaagaaggtc
gacggcctcacctacacggaccgcgcgacgggcgcgagccatcgcgtggcactggaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctcaagggcacggtggagttg
tcgaagcacggcgagatcgtcgtcgatgcgaagggcgcgacctcgttgcccggcgtattc
gccgcgggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcgtcgctctccgcgttcgaccacctgatccgtgcgtcggtggaagatgaagca
gtggtcgaagaagaagtgacggcgtga

DBGET integrated database retrieval system