KEGG   Burkholderia insecticola: BRPE64_CCDS00380Help
Entry
BRPE64_CCDS00380  CDS       T02684                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
buo  Burkholderia insecticola
Pathway
buo00564  Glycerophospholipid metabolism
buo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRPE64_CCDS00380 (glpD)
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BRPE64_CCDS00380 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 Pyr_redox_2 GIDA Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: BAN26121
UniProt: R4X1G4
LinkDB All DBs
Position
3:35576..37138
Genome map
AA seq 520 aa AA seqDB search
MQTTLPSERASLLRELDRTPVFDVVVIGGGASGLGTAVDAASRGYRTLLLEARDFAKGTS
SKATKLVHGGVRYLAQGNIPLVREALRERGLLARNAPHLVHSLGFVVPAYRFGDKFIYGA
GLKMYDWLAGSLNLGASRSLSLAETRAKSPMLADSLNGHALRGGTLYRDGQFDDARLAIA
LMRTLFDLGGVALNNAAVRGVGFDRAAGHHRLSVEDVETGDMLSVGARCLVNATGVWVDS
IRAMAEPGVRPIVAPSQGVHLTLPGRFLQSNDAILVPKTKDGRVLFMVPWHGHTIVGTTD
TPRQDLPLDPRASDEDIDFILATASDYLSVKPTRDDVLSVWAGLRPLVKGDADSSTKSLS
REHTIEMNATGMITVTGGKWTTYRLMAQQVIDLAVEKRLLPDAPCRTASLALHGATAEQH
GYYGSDAARIGRLPGADKVLVKASGLTEAQTRFAVRAELARCVEDVLARRNRALFLDAAA
ARAAAPEVARIMAEELGKPLQWQAEEVARFDEFARTWMLS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccactcttccttccgagcgcgcatcgttgctgcgcgaactggaccggacgccg
gtcttcgatgtcgtcgtgatcggcggcggcgcgagcggcctcggcacggccgtcgatgcg
gcctcgcgcggttatcgaacgctgttgctggaggcgcgcgatttcgccaagggcacgtcg
agcaaggcgaccaagctcgtgcacggcggcgtgcgctatctcgcgcagggcaacattccg
ctggtgcgcgaggcgctgcgcgaacgcggcctgcttgcgcgcaacgcgccgcatctggtg
cactcgctcggcttcgtggtgccggcgtatcgcttcggcgacaagttcatctacggcgcg
ggtctgaaaatgtacgactggctcgcgggctcgctcaatctcggcgcgagccgcagcctg
agccttgcggagacgcgcgcgaaatcgccgatgctcgccgacagcctcaacggccatgcg
ctgcgcggcggcacgctctaccgcgacggccagttcgacgacgcgcggctcgccattgcg
ctgatgcgcacgctgttcgatctcggcggcgtcgcgctgaacaatgcggccgtgcgcggc
gttggcttcgatcgtgcggcgggacatcatcggctgtcggtggaggacgtcgaaacgggc
gatatgctcagcgttggcgcgcgctgcctcgtcaacgcgacgggcgtgtgggtcgattcg
atccgcgcgatggccgagcccggcgtgcgcccgatcgtggcgccgagtcagggcgtgcac
ctgacgctgcccggccgcttcctgcaaagcaacgacgcgattctcgtgcccaagaccaag
gacggccgcgtgctgttcatggtgccgtggcatggtcatacgatcgtcggcacgacggat
acgccgcgtcaggatttgccgctcgacccgcgcgcgagcgacgaggacatcgacttcatt
ctcgcgacagcgtccgattatctgtcggtcaagccgacgcgcgacgacgttctcagcgtg
tgggccggtcttcgtccgctcgtgaagggcgatgccgattcatcgacgaaatcgttgtcg
cgcgagcacaccatcgaaatgaatgcgacgggcatgatcaccgtgacgggcggcaagtgg
acgacgtatcgcctgatggcgcagcaggtcatcgatctggcggttgagaagcgtctgttg
ccggatgcgccgtgccgcacggcgtcgctggcgctgcatggcgcgaccgcggagcagcac
ggctattacggttccgatgccgcgcgtatcgggcgtctgcccggcgcggacaaggtgctg
gtgaaggcaagcggtttgaccgaagcgcagacgcgcttcgcggttcgggccgagcttgcg
cgctgtgtggaagacgtgctggcgcggcgtaatcgcgcgctgtttctcgacgccgccgcg
gcacgcgcggcggcgcctgaagtcgccagaatcatggcggaggaactcggcaagccgttg
cagtggcaagccgaggaggtcgcgcgattcgatgaattcgcgcggacgtggatgctttct
tag

DBGET integrated database retrieval system