KEGG   Burkholderia insecticola: BRPE64_DCDS02550Help
Entry
BRPE64_DCDS02550  CDS       T02684                                 

Definition
(GenBank) aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
buo  Burkholderia insecticola
Pathway
buo00010  Glycolysis / Gluconeogenesis
buo00620  Pyruvate metabolism
buo01100  Metabolic pathways
buo01110  Biosynthesis of secondary metabolites
buo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRPE64_DCDS02550
   00620 Pyruvate metabolism
    BRPE64_DCDS02550
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BRPE64_DCDS02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: BAN27191
UniProt: R4X377
LinkDB All DBs
Position
p1:264164..265867
Genome map
AA seq 567 aa AA seqDB search
MNSRCAPRENPDDVARSRTQRARAAWRHRRPHDGMELANESHGAGHRCAGPFMSTCEEHT
QMNHAEMQFLSTEYPYKKQYGNFIGGKWVPPAGGEYFDNISPITGEPFTSIPRSRDADIE
AALDAAHAAKTAWGRTSVTDRANVLMKIADRMEANLQRLAVAESIDNGKPLRETMAADIP
LAIDHMRYFASAARAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAIWKLAPAL
AAGNCVVLKPAEQTPASILVLLEVIGDLLPPGVLNVVNGFGLEAGKPLASNKRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLNADDSFFDKALEGFTMFALNQGE
VCTCPSRALVEESIYERFMERALKRVAAIAQGHPLDSKTMIGAQASHEQLEKILSYIDLG
KQEGAECLAGGERNAMDGELKNGYYIKPTVFKGHNKMRIFQEEIFGPVLSVTTFKNEEEA
LKIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
NHKMMLDHYQQTKNMLVSYSDKPLGFF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagtcgatgcgcacctcgtgaaaaccctgacgatgtcgcgcgaagccgcacgcag
cgggcgcgtgcagcatggcgacatcgccgcccgcacgatggcatggaactcgcaaacgag
agccacggcgccggacatcgttgtgccggcccgttcatgtcgacatgcgaggagcacaca
caaatgaatcacgcagagatgcagttcctgagcaccgagtacccgtacaagaagcaatac
ggcaacttcatcggcggcaagtgggtgccgccggcgggcggtgagtatttcgacaacatc
tcgccgatcaccggcgaaccctttacgtcgattccgcgttcccgcgacgccgatatcgaa
gccgcgctcgatgcggcgcacgccgcgaagacggcgtggggcaggacttccgtcacggat
cgcgcgaatgtgctgatgaagatcgccgaccgcatggaagccaacttgcagcgcctcgcg
gtggccgagtcgatcgacaacggcaagccgctgcgcgagaccatggccgcggacattccg
ctcgcgatcgatcacatgcgctacttcgcgagcgcggcgcgcgcgcaggaaggcgggatt
tcggagatcgatcacgataccgtcgcctatcactttcatgagccgctcggtgtcgtcggg
cagatcattccgtggaatttcccgattctgatggcgatctggaaactcgcgcccgcgctc
gccgccggcaattgcgtcgtgctgaagccggccgagcagacgcccgcgtcgattctcgtg
ctgctcgaagtgatcggcgacctgttgccgccgggcgtgctcaacgtcgtgaacggcttc
gggctggaggcgggcaagccgctcgcgtcgaacaagcgcattgcgaagatcgcgttcacc
ggcgaaaccacgaccggccgcctgatcatgcagtacgcgagccagaacctgattcccgtc
acgctcgaactgggcggcaagagcccgaacatcttcttcgccgatgtgctgaatgccgac
gacagcttcttcgacaaagcgctcgaaggcttcacgatgttcgcgctgaatcagggcgaa
gtgtgcacgtgtccgtcgcgtgcgctggtcgaggaatcgatctacgaacgcttcatggaa
cgcgcgctcaagcgcgtcgcggcaatcgcgcagggccatccgctcgacagcaagacgatg
atcggcgcgcaggcttcgcacgagcaactggagaagatcctgtcgtatatcgacctcggc
aagcaggaaggcgccgaatgcctcgcgggcggcgagcgcaacgcgatggatggcgaactg
aagaacggttactacatcaagccgaccgtgttcaaaggccacaacaagatgcgcatcttc
caggaggaaatcttcgggccggtgctctcggtgacgaccttcaagaacgaggaagaggcg
ctcaaaatcgcaaacgacacgctgtatggtctgggcgcgggcgtatggacgcgcgatggt
acgcgtgcgtatcgcttcggccgcgcaattcaggcgggccgtgtgtggaccaactgctat
cacgcgtatccggcgcatgcggcgttcggcggctacaagcaatcgggcatcggacgcgaa
aatcacaagatgatgctcgatcactatcagcagacgaagaacatgctcgtcagctacagc
gacaagccgctcggcttcttctga

DBGET integrated database retrieval system