KEGG   Burkholderia insecticola: BRPE64_DCDS02910Help
Entry
BRPE64_DCDS02910  CDS       T02684                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
buo  Burkholderia insecticola
Pathway
buo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:buo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BRPE64_DCDS02910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:buo03400]
    BRPE64_DCDS02910
Enzymes [BR:buo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BRPE64_DCDS02910
DNA repair and recombination proteins [BR:buo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BRPE64_DCDS02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4130 UDG
Motif
Other DBs
NCBI-ProteinID: BAN27227
UniProt: R4X4E9
LinkDB All DBs
Position
p1:304545..305963
Genome map
AA seq 472 aa AA seqDB search
MRTITIDDDFDAWRTAALDALAQQLTPESIDWRTTQAEPALFAAEAPALQQPSEAPQIRV
SREFATLLKDAAHFRDERRWSFLYRVLWRWTQGDRSVASPADEDGARLYKMAKAVRRAQH
DMIAYVRFRQRDAALGAPEYVAWYEPDHDVLVWGADHFAARMGRSTWLIATPHGAAMFDG
EHLQIERRRALAAEHAVDTPDAAETLWMTYYRSIFNPARLNETALEQHMPVRFWKGLPEG
ALIPQLVSAARGGARRVAQAQGVGARGGKAVQVEAQEAQPERDAPTSLDTCRRCDLWRNA
TQAVHGAGPSDARIMLLGEQPGDQEDLKGEPFVGPAGQLLDDAMRRAGVPREQVYLTNAV
KHFKWEPRGKRRLHKTPAQQEVDACAYWLEQELRDVGAQVIVTLGATALAALFGRRATLS
AHLGRVVTYGDKSVVATYHPSYALRQNDEAARERTVAAIVEALERARTLIAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccatcaccatcgacgacgatttcgacgcctggcgcaccgccgcgctcgacgcg
ctcgcgcagcaactcacacccgaatcgatcgactggcgcacgacgcaggcggagccggcg
ttgttcgcggcagaggcaccggcattgcagcaaccgtccgaagcaccgcaaatccgcgta
tcgcgagaatttgcgacgctattgaaagacgccgcgcatttccgcgacgaacgccgctgg
agcttcctttaccgcgtgctctggcgctggacgcagggcgaccgttcggtcgcgtcgccc
gccgacgaagacggtgcgcggctctacaaaatggcgaaggcggtgcggcgcgcgcaacac
gacatgatcgcgtacgtgcgctttcgccagcgcgatgcggcactcggcgcgcccgaatat
gtcgcgtggtacgagcccgatcacgatgtgctcgtctggggcgccgaccattttgccgcg
cgcatgggccgctcgacgtggctcatcgcaacgccccacggcgccgccatgttcgacggc
gagcatctgcaaatcgagcgccgtcgcgcgttggcggcggaacacgccgtcgatacgccg
gacgccgccgaaacgctgtggatgacgtattaccgcagcatcttcaaccccgcgcgcctg
aacgaaaccgcgctcgaacagcacatgccggtgcgcttctggaaaggcttgcccgagggc
gcgctgatcccgcaactcgtgagcgccgcacgcggtggcgcgcgtcgggtcgcgcaggcg
cagggcgtcggcgcgcggggcggaaaggccgttcaggtcgaggctcaggaggcgcaaccc
gaacgcgacgcgccgacctcgctcgacacctgccgccgctgcgatctgtggcgcaacgcg
acgcaggccgtgcacggcgcggggccgtccgatgcgcgcatcatgctgctcggcgagcag
cccggcgatcaggaagacctgaagggcgagccgttcgtcggaccggcgggccagcttctc
gacgacgccatgcggcgcgcgggcgtgccgcgcgagcaggtctatctgaccaacgccgtg
aagcatttcaaatgggagccgcgcggcaagcggcggctgcacaagacgccggcgcagcaa
gaagtcgatgcgtgcgcgtactggctcgaacaggaacttcgcgatgtcggcgcgcaggtg
atcgtcacgctcggcgcgacggcgctcgccgcgctctttggccgtcgcgcaacgctgtcg
gcgcatctcggccgcgtcgtgacgtatggcgacaaatcggtcgtggcgacgtatcacccg
tcgtatgcgctacgccagaacgacgaggccgcgcgcgagcgcaccgtcgcggccatcgtc
gaggcgttggaacgggcgcggacgctcatcgcgcgataa

DBGET integrated database retrieval system