KEGG   Burkholderia insecticola: BRPE64_DCDS06220Help
Entry
BRPE64_DCDS06220  CDS       T02684                                 

Gene name
fabB
Definition
(GenBank) beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
buo  Burkholderia insecticola
Pathway
buo00061  Fatty acid biosynthesis
buo00780  Biotin metabolism
buo01100  Metabolic pathways
buo01212  Fatty acid metabolism
Module
buo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BRPE64_DCDS06220 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BRPE64_DCDS06220 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:buo01004]
    BRPE64_DCDS06220 (fabB)
Enzymes [BR:buo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     BRPE64_DCDS06220 (fabB)
Lipid biosynthesis proteins [BR:buo01004]
 Fatty acid synthase
  Component type
   BRPE64_DCDS06220 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAN27558
UniProt: R4WSC2
LinkDB All DBs
Position
p1:complement(648223..649440)
Genome map
AA seq 405 aa AA seqDB search
MQRVVVTGMGIVSCLGNSLDAVSHALREGRSGITRIDAWRERGFHSQVAAVASVADEPPF
ERKLERFMGDTARFACHAARKAIDDAMLDDATLRSPKTGAVIGSGVGAMAEYDVAIATVQ
AHGIDRTPPYTVPRAMSSTASANVVQTFGIEGVAYSPSSACTTSALAIGQAMQLIQTGRQ
HVVLAGGSEALHDNMTLMFDAMHALSRGFNDTPSRASRPYDTARDGFVIGSGAGVLVLES
LDHARARGARIYAELTGFGESTDGAGMVTPHSNGIARALRMALDEAGGVDEWPEYINTQA
PSTPLGDAEELHALRDVFGTRVPPFSSTKGMTGHPLGACGAHEAIYTLLMMRDGFIAGTR
RVDSTDPVVRDMPLVQTTRDGRIDRAMSVSFGFGGSCAALMFARV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgtcgtcgtgacgggcatgggcatcgtttcgtgtctcggcaattcgctcgac
gcggtgagccatgcgttgcgcgaaggccgcagcggcatcacgcggatcgacgcgtggcgc
gagcgcggttttcattcgcaggttgcggcagtggcatcggtcgctgacgaaccaccgttc
gagcgcaagctggagcgcttcatgggcgacaccgcgcgcttcgcgtgtcacgcggcgcgc
aaagcaatcgacgacgcgatgctcgatgacgccacgctgcgctcgccgaagacaggcgcg
gtgatcggctccggtgtcggcgcgatggcggagtacgacgtggcgatcgccacggtgcag
gcgcacggcatcgacagaacgccgccgtacacggtgccgcgcgcgatgagcagcacggcg
tcggcgaacgtcgtgcagaccttcggcatcgagggtgtcgcgtactcgccttcatcggcg
tgcacgacgtcggcgcttgcaatcgggcaggcgatgcagctcatccagacgggacggcaa
cacgtcgtgctcgcgggcggcagcgaggcgctgcacgacaacatgacactgatgttcgat
gcgatgcatgcgttgtcgcgcggcttcaacgacacgccgtcgcgcgcctcgcgtccatac
gatactgcccgtgatggcttcgtgatcggctccggcgcgggcgtgctggtgctcgaatcg
ctggatcatgcacgtgcgcgcggtgcacgcatctatgcggaactgacgggctttggcgaa
agcacggatggcgcgggcatggtcacgccgcacagcaacggcatcgcgcgcgcacttcgc
atggcgctcgatgaagcgggcggcgtcgatgaatggcccgagtacatcaacacgcaagcg
ccttccacgccgctcggcgacgcagaggaactgcacgcgttgcgcgacgtatttggaacc
cgcgtgccgccgttttcgtcgacgaaaggcatgacagggcatccgctcggagcatgcggc
gcgcacgaggcgatctacacgttgctgatgatgcgcgatggttttatcgcaggcacacgg
cgcgtcgattcgacggacccggtcgtgcgcgatatgccgctcgtacagaccacacgcgac
gggcgcatcgaccgtgcgatgtcggtgtcgttcggattcgggggaagttgcgcggcgctg
atgttcgcaagagtttga

DBGET integrated database retrieval system