KEGG   Buchnera aphidicola TLW03 (Acyrthosiphon pisum): CWQ_01410Help
Entry
CWQ_01410         CDS       T01829                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bup  Buchnera aphidicola TLW03 (Acyrthosiphon pisum)
Pathway
bup00061  Fatty acid biosynthesis
bup00780  Biotin metabolism
bup01100  Metabolic pathways
bup01130  Biosynthesis of antibiotics
bup01212  Fatty acid metabolism
Module
bup_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CWQ_01410
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CWQ_01410
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CWQ_01410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bup01004]
    CWQ_01410
Enzymes [BR:bup01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CWQ_01410
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CWQ_01410
Lipid biosynthesis proteins [BR:bup01004]
 Fatty acid synthase
  Component type
   CWQ_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ADP66659
LinkDB All DBs
Position
291785..292405
Genome map
AA seq 206 aa AA seqDB search
MKSCIVLCCDVSNDKNIKKLFIDLGQVWKKFDGLVHAIAYCPKQYFNGDFIDNITREGFN
ISHEISSYSFIGLVKACRTMLNNFSSLLTLSYLGSQRVVPNYNVMGLAKASLEASVRYMA
SSLGKENIRVNAISSSPIKTISSYKITNFNKIRNCSYASSFLKNSVTSENIGNVASFLLS
DLSLGITGSVIYVDNGFNVSSMNNIQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttgtatcgtactatgttgtgacgtttctaatgataaaaatattaaaaaatta
tttatagatttaggtcaggtatggaagaaatttgacggattagttcatgcaattgcttat
tgtccaaagcaatattttaatggagattttattgataatattaccagagaaggttttaat
atttctcatgaaattagttcttatagttttataggattggttaaagcctgcagaacaatg
ttaaacaatttttcttctttattgactttatcttatttaggttcacaacgtgtcgtgcct
aattataatgttatgggtttagctaaagcttcattagaagcaagtgtccgttatatggct
agttcattaggaaaagaaaatattcgtgtcaacgctatttcgtctagtcctattaagact
atttcctcttataaaattacaaattttaataaaatacgaaattgttcttatgcatcttct
tttttaaaaaattctgttaccagtgaaaatataggaaatgtagcatcctttttattgtct
gatttgtctttaggtattactggttcagttatttatgttgacaatggttttaatgtcagc
agcatgaataatattcaataa

DBGET integrated database retrieval system