KEGG   Burkholderia sp. HB1: AC233_00225Help
Entry
AC233_00225       CDS       T04094                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00010  Glycolysis / Gluconeogenesis
buq00620  Pyruvate metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AC233_00225
   00620 Pyruvate metabolism
    AC233_00225
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AC233_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ALE53324
UniProt: A0A0M4PM08
LinkDB All DBs
Position
1:complement(70918..72438)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPFKKQYANFIGGEWVKPVGGEYFDNVSPITGEPFTSIPRSREADVEL
ALDAAHRAKAAWGKTSTTDRANILNRIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGSISEIDDDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLAELIQDLLPAGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNQDDSYFDKALEGFAMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTKTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNTLSGELSKGYYVKPTVFRGNNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggagatgcagtttctgacgaccgaattcccgttcaaaaagcagtatgcg
aactttatcggcggcgaatgggtgaagcccgtgggtggcgagtacttcgacaatgtgtcg
ccgattacgggcgaaccgttcacctccattccgcgctcgcgcgaagcggatgtcgagttg
gcgctcgatgccgcgcaccgagccaaagctgcgtggggcaagacgtcgacgacggatcgc
gcgaacattctgaaccgcattgccgaccgtatggaagcgaacctgcagcgccttgcagtg
gcggaaacgatcgacaacggcaagccgctgcgcgaaacgatggccgccgatattccgctt
gccatcgatcatttccgctatttcgccggcgccgtgcgtgcgcaggaaggttcgatctcc
gagatcgacgacgacaccgtggcctatcattttcatgagccgctcggcgtagtcggtcag
atcattccgtggaatttccccattctgatggccgtgtggaagctcgcccccgcactcgca
gccggcaattgcgtcgtgctcaaacccgcggagcaaacgcccgcgtccattctcgtactc
gctgaactgattcaggacttgctgcccgccggcgtgctgaatgtggtgaacggtttcggt
ctcgaagccggcaaaccgctcgcgtcgagcaagcgcatcgcgaagatcgcgtttaccggc
gagacgacgacaggccgtctgatcatgcagtacgcgagccagaacatcattccggtgacg
ctggaactcggcggcaagagcccgaatattttcttcgccgacgtgatgaatcaggacgac
agctatttcgacaaagcactcgaaggcttcgcgatgttcgcgttgaatcagggcgaggtg
tgcacgtgtccgtcgcgcgtgttgatcgatgaaaagatctatgaccgcttcatggaacgt
gcgttgaagcgcgtcgcggcgatcacgcagggtcatccgctggatacgaaaacgatgatc
ggtgcgcaggcttcgcaggaacaattggagaagatcctgtcgtatgtcgatctcggcaag
caggaaggcgccgagtgtctgatcggcggcgaacgcaatacattgagcggtgaattgagc
aaaggctattacgtgaagccgaccgtgtttcgcggcaataacaaaatgcgcatcttccag
gaagagatcttcgggccggtggtttcggtcacaacgttcaagaccgaagaagaagcactc
gaaatcgccaacgacacgctttacggtctcggcgccggcgtatggacacgcgacggcacg
cgcgcctatcgctttggccggcaaattcaggcgggccgcgtgtggaccaattgctatcac
gcatatcccgctcacgcggcgtttggcggctacaagcaatcgggcattggccgcgagaac
cacaagatgatgctcgaccattatcagcagacgaagaacctgctcgtcagctatagcgag
aaaccgctcggcttcttctaa

DBGET integrated database retrieval system