KEGG   Burkholderia sp. HB1: AC233_01340Help
Entry
AC233_01340       CDS       T04094                                 

Definition
(GenBank) cytochrome C550
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00550  Peptidoglycan biosynthesis
buq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AC233_01340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:buq01002]
    AC233_01340
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buq01011]
    AC233_01340
Enzymes [BR:buq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AC233_01340
Peptidases and inhibitors [BR:buq01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AC233_01340
Peptidoglycan biosynthesis and degradation proteins [BR:buq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AC233_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ALE53513
UniProt: A0A0M4NKW4
LinkDB All DBs
Position
1:317699..318928
Genome map
AA seq 409 aa AA seqDB search
MRFSTSGRLSFPSVASFVPSTPARAFALGVVLPATLVASTAFAQVPPPAVNARSWVLVDA
TSNQVLASGNPDERVEPASLTKLMTAYLVFEALQTKKITMDQTVTPGEAVRRVRTDESRM
FIEANKPVTVHDLVYGMIVQSGNDAAIALAELVGGSESQFVNMMNTEAQRLGMKHTHFAD
VNGMPDPQHYTTAGDLAVLSARLIRDFPDYYNIFSVKDFTYNKIKQPNRNRLLWIDPTVD
GLKTGHTQAAGYCLIASAKRSLPGTPDASRRLVSVMMGETKEHDRVQDSLKMLNYGYSAY
DTARLYKANQVVGTPRVYKGAQDTVQIGVKSDQYITVPKGMADKVKPQIEQIDPLIAPIA
NGQQVGTAKLVADGKVLAQFPVVALQAVPQAGVVGRVWDSLMLMFNKKK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttcgacctccggccgcctgtctttcccctctgttgcatcctttgttccttcc
acgccagcccgcgcattcgcgctcggcgtcgtgctgcccgcaacgctcgtggccagcacc
gcgttcgcgcaagtgccgccgccggcggtgaacgcgcgctcgtgggtgctcgtcgacgcg
accagcaatcaggtgctcgcgtcgggcaatcccgacgaacgcgtggaacccgcttcgctc
acaaagctgatgaccgcgtatctcgtcttcgaagcattgcagacgaagaagatcacgatg
gaccagacggtgacgccgggcgaagcggtgcgccgcgtgcgcacggacgaatcgcgcatg
ttcatcgaggcgaacaagcccgtcaccgtgcacgatctggtgtacggcatgatcgtgcag
tcgggcaacgacgcagcgatcgcgctggccgaactggtcggcggcagcgagtcgcagttc
gtcaacatgatgaacaccgaggcgcagcgccttggcatgaagcacacgcatttcgccgac
gtgaacggcatgcctgacccgcagcactacacgaccgccggcgacctcgcggtgctgtcg
gcgcgtctgattcgcgacttccctgactactacaacatcttctcggtcaaggatttcacg
tacaacaagatcaagcagccgaaccgcaatcgtctcttgtggatcgacccgacagtggac
ggcctgaagaccggccacacgcaggccgccggctactgcctcatcgcaagcgcgaagcgt
tcgctgccgggcacgcccgacgcatcgcgccggctcgtctccgtgatgatgggcgagacc
aaggaacacgaccgcgtgcaggacagcctgaagatgctgaactacggctactccgcgtac
gacacggcgcgcctctacaaggcgaatcaggtggtcggcacgccgcgcgtctacaagggc
gcgcaggacaccgtgcagatcggcgtgaagagcgatcagtacatcaccgtgccgaagggc
atggccgacaaggtcaagccgcagatcgagcagatcgatccgctgatcgcgccgatcgcc
aacggtcagcaggtcggcaccgccaagctggttgccgacggcaaggtgctcgcgcaattc
ccggtggtcgcattgcaggccgtgccgcaggccggcgtggtgggccgcgtgtgggattcg
ctgatgctcatgttcaacaagaaaaagtaa

DBGET integrated database retrieval system