KEGG   Burkholderia sp. HB1: AC233_05520Help
Entry
AC233_05520       CDS       T04094                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AC233_05520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buq02000]
    AC233_05520
Enzymes [BR:buq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AC233_05520
Transporters [BR:buq02000]
 Other Transporters
  Pores ion channels [TC:1]
   AC233_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 Tom37 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALE54241
UniProt: A0A0M3TV18
LinkDB All DBs
Position
1:1261696..1262343
Genome map
AA seq 215 aa AA seqDB search
MIKLCGFALSNYYNKVKFVLLEHGIEFEEVFVQPSQDEAVVAHSPLGKVPYLQTEDGDLC
ESQCIVEYLAARFPDKRIFSADPWEAAKERELITFVDVHLELTARNLYKEAFFGGTVTDA
TKGRVEKLLAHHIAGFRRIAKFAPYLRGERFSIADAAGFVSLPLVGMTTQAIYGRDFLLD
AGVDWKSYVKAINGRPAAQRVTEDRKAYIAASRPA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctctgcggattcgcgctttcgaactactacaacaaggtgaagttcgttctg
ctggaacacggcatcgagttcgaggaagtgttcgtgcagccgagccaggacgaggccgtc
gtcgcgcattcgccgcttggcaaagtgccttacctgcagacggaagacggcgatctttgc
gagtcgcaatgcattgtcgaatacctggccgcgcgctttcccgacaagcggattttctcc
gccgatccgtgggaggccgcgaaggagcgcgagttgatcacgttcgtcgacgtgcatctg
gagctgacggcgcgcaatctgtacaaggaagcgtttttcggcggcaccgtcaccgacgcg
accaagggccgcgtcgagaagctgcttgcgcatcacatcgcgggcttcaggcggatcgcg
aagttcgcgccgtacttgcgcggcgaacggttcagtatcgcggacgccgcgggcttcgtg
agcttgccgcttgtcggcatgacgacgcaggctatttacggccgcgactttttgctcgat
gccggcgtggactggaaaagctatgtgaaggcgatcaacggacggcccgccgcgcagcgc
gtgaccgaggaccgtaaggcgtatatcgcggcgtcgcgtccggcttga

DBGET integrated database retrieval system