KEGG   Burkholderia sp. HB1: AC233_06855Help
Entry
AC233_06855       CDS       T04094                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AC233_06855
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AC233_06855
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AC233_06855
    1.1.1.-  
     AC233_06855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_3 Shikimate_DH YdfZ
Motif
Other DBs
NCBI-ProteinID: ALE56523
UniProt: A0A0M5LG93
LinkDB All DBs
Position
1:complement(1600437..1601507)
Genome map
AA seq 356 aa AA seqDB search
MRAVRFHCAHDVRVENVPDPTGMGANQMIVKPLWCGICGTDLHEYQAGPIVVPTEPHALT
GAKAPQVLGHEFSAEVVEVGKDVKNVQRGDRISVMPLASCGQCYYCARGMRHLCSKMGCV
GLSWDGGGMAEYTLLNDYHANRLPDTVSDKQGALIEPAAVALYAVDRGGVTVGSTVLITG
AGPIGVLAALACHAAGATKIFVSEPNAARADKMAGFGVTTAIFDPSDGELPQKIRDLTEG
VGVDVAIECAGNQHALNACVDAVRSAGAVVQAGLHVGTASVDPMKWSLKDIRIEGTWCYP
VTIWPRIIGMIANGKFPVEKLIHDLIDADEVVEKGFDVLSDKGSDKMKILINPQTR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtgcgttttcactgtgcgcacgatgtccgggtcgaaaacgtaccggacccg
acgggcatgggcgcgaaccagatgatcgtcaagccgctgtggtgcggcatctgcggcacc
gatctgcacgagtatcaggcggggcccatcgtggtgccgaccgaaccgcatgcgctgaca
ggcgcgaaagcgcctcaggtgcttggccatgaattcagcgcggaagtcgtcgaagtcggc
aaggacgtgaagaacgtgcaacgcggcgaccgcatctcggtgatgccgctcgcgtcgtgc
ggacagtgctattactgcgcgcgcggcatgcgccatctgtgctcgaaaatgggctgcgtc
gggctcagttgggacggcggcggaatggccgaatacacgctgctcaacgactatcacgcg
aaccgcttgcccgacaccgtgagcgacaaacagggcgcgttgatcgaacccgccgctgtc
gcgctgtatgcggtcgaccgtggcggcgtcacggtcggctccacagtgctgatcaccggc
gcaggcccgatcggcgtacttgccgccctcgcctgccatgcagcgggcgccacgaagatt
ttcgtgagcgaacccaatgcggcgcgagccgacaagatggccggcttcggcgtcacgacc
gcaatcttcgatccatccgacggcgaactgccgcaaaagattcgcgacctgacagaaggc
gtcggcgtggacgtggcgatcgaatgcgcgggcaaccagcatgcgctgaacgcatgcgtc
gacgcggtgcgatcggcgggcgctgtggttcaggcgggtctgcacgtgggcacagcgagc
gtcgacccgatgaaatggtcgctgaaggacatccggatcgaaggcacatggtgttacccc
gtcacgatctggccgcgcatcatcggcatgatcgcgaacggcaagttcccggttgaaaag
ctcattcacgatctgatcgatgccgacgaagtcgtcgagaaaggctttgacgtactgagc
gacaaaggcagcgacaagatgaagattctcatcaatccccagacacggtga

DBGET integrated database retrieval system