KEGG   Burkholderia sp. HB1: AC233_07635Help
Entry
AC233_07635       CDS       T04094                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
buq  Burkholderia sp. HB1
Pathway
buq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:buq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AC233_07635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:buq03400]
    AC233_07635
Enzymes [BR:buq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AC233_07635
DNA repair and recombination proteins [BR:buq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AC233_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ALE54602
UniProt: A0A0M4P0Q5
LinkDB All DBs
Position
1:1767306..1770104
Genome map
AA seq 932 aa AA seqDB search
MNDRLDLYNRKRRFDETPEPAGTAAKKRGSRGATRPTVEQGLSYVIQEHHARRLHYDFRL
ELNGALLSWAVPKGPSLDPSVKRLAVHVEDHPVEYGTFEGEIPPGNYGAGTVIVWDRGTW
EPVGGPAEAARAYRAGKLKFHLHGDKLHGGWTLVRSHMRGDADKEQWLLIKERDDEARDE
SEYDILAERPGSVLSGAAPSAGKGKAGKQSAGKTRTASVRGDPKRPDIVATRSSESLREL
AASPAIEGAVKAKLPASLKPQLATLVDATPPGDDWTYEIKFDGYRVLARIDASEKSRGVQ
VFTRAGNDWTAKFSKQVKAFAQLGLDSAWLDGEAVVLDENGVPSFQALQNAFDSNRPQDI
VVYLFDVPFLNGYDLRGVPLQQRRAILRALLEPVDDSVLRFSNDFEFSADDLLKSACDMA
LEGIIGKRRDSGYVSGRSATWIKLKCRRRQEFVIGGYSEPSGSRAAFGALLLGVHDSKGK
LQYAGRVGTGFDAALLRSVKKELDAHETKRMPFASTPRERSRTPVHWVEPVLVAECNFAE
WTSDGIVRQASFVSLRKDKPARQIVKEAPRKGDDVQQQTDIEAEVAPKKRAARGEANKTA
TKSASKVATKTASKVATKSATQNSAEPTAPRAKKSSPAEVAGVRISHPDRVIDKSTGARK
IDLVQYYESVAQWMLPHLIDRPVSLVRAPEDIGGELFFQKHTQKLSIPNITQHPGLDPGH
PPLITVDSAKALVGAAQMGTIEFHTWNGVASNIEKPDRVVFDLDPDPSLGWDRMIEAAML
TRSLLEELGLTSFCKTSGGKGLHVVVPLSKHAGWDEVKEFSQAVAQHMASTLPKYFSAKM
GAQNRKQKIFVDYLRNNRGSSTVAAFSVRARPGLGVSVPLAWDEVAQTTGGDQWNIENLH
ERLDELKGDPWADYAKTRQRITAAMRKRLSGA
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacagactcgacctctataaccgcaagcgccgcttcgacgaaacgccggagccc
gcgggcaccgccgcgaaaaagcgcggcagccgcggcgccacccggccgacagtcgaacag
ggcctctcctacgtgatccaggaacaccacgcacggcgtctgcactatgacttccggctc
gaactgaacggcgcgctgctgtcgtgggccgtgccgaaagggccgagcctcgatccgtca
gtgaagcgcctcgccgtgcatgtcgaagaccatccggtcgaatacgggacgttcgaaggc
gagattccgccgggcaattacggcgcgggcacagtcatcgtatgggaccgcggcacgtgg
gaacctgtcggcggcccggccgaagcggcgcgcgcgtatcgcgcgggcaagctcaagttc
catctgcacggcgacaagctgcacggcggctggacgctcgtgcgcagccacatgcgcggc
gacgcggacaaggaacagtggctcctcatcaaggaacgcgacgacgaggcgcgcgacgaa
agcgaatacgacattctcgccgaacggcccggcagcgtgctgagcggcgccgcgccgtct
gcggggaagggaaaagccggcaagcagagcgccggcaaaaccagaaccgcctcggtgcgc
ggcgatccgaagcgccccgacatcgtcgcgacacgcagcagcgagtcgctgcgcgaactc
gccgcatcgcccgcgatagaaggcgcggtgaaggccaaactgcctgcatcgctgaagcct
caactggcgacgctcgtcgacgcgacgccgcccggcgacgactggacatacgaaatcaag
ttcgacggctatcgcgtgctggcccgcatcgacgcaagcgagaaaagccgcggcgtgcag
gtcttcacgcgcgcgggcaacgactggaccgcgaaattcagcaagcaggtgaaggcgttc
gcgcaactgggcctcgacagcgcgtggctcgacggcgaagccgtggtgctcgacgaaaac
ggcgtgccgagtttccaggcgctgcaaaacgcgttcgattcgaaccgtccgcaagacatc
gtcgtctatctgttcgacgtgccgtttttgaacggctacgacttgcgcggcgtgccgctg
caacagcgccgcgcgattttgcgcgcgctgctggagcccgtcgacgacagcgtgctgcgt
ttttcgaacgacttcgagttcagcgccgacgatctgctgaaaagcgcgtgcgacatggcg
ctcgagggcatcatcggcaagcggcgcgacagcggctatgtgtccggccgctcggccacg
tggatcaagctgaagtgccgtcggcggcaggagttcgtgatcggcggctattcggaaccg
tcgggcagccgtgcggcgttcggtgcgctgctgctcggcgtgcacgacagcaagggcaaa
ctgcagtatgcggggcgcgtgggcaccggtttcgacgccgcgttgctgcgctcggtgaag
aaggaactcgacgcgcacgaaacgaagcgcatgccgttcgcgagcacaccgcgcgagcgc
agccgcacgcccgtacattgggtcgagccggtgctcgtcgcggaatgcaatttcgccgaa
tggacgagcgacggcatcgtgcgtcaggcgtcgttcgtgagtctgcgcaaggacaagccg
gcgcgccagatcgtcaaggaagcaccacgcaagggggacgacgtgcaacagcaaaccgac
atcgaggccgaggtcgcgccgaaaaagcgtgcggcgcgcggcgaggccaacaaaaccgcc
accaaatccgccagcaaagtggccacgaaaaccgcgagcaaagtagccaccaaatccgcc
acccaaaactcagccgaacccaccgcaccgcgagccaaaaaatcctcgcccgccgaagtc
gccggcgtccgcatctcgcatcccgaccgcgtcatcgacaagagcaccggcgcgcgcaag
atcgacctcgtgcagtactacgaatccgtcgcgcaatggatgctgccgcatctcatcgac
cgacccgtgtcgctcgtgcgcgcgccggaggacatcggcggcgagctgttttttcagaag
cacacgcagaagctgtcgattccaaacatcacgcagcatcccgggctcgatccgggtcat
cctccgctgatcaccgtcgatagcgcgaaggcgctcgtcggcgccgcgcaaatgggcacg
atcgaatttcacacatggaacggcgtggcgtcgaacatcgaaaagcccgaccgtgtggtg
ttcgatctcgacccggacccgtcactcggctgggaccggatgatcgaggccgcgatgttg
acgcgctcgctgctcgaggaactcggcctcacgtcgttctgcaagacgagcggcggcaaa
ggtcttcacgtggtcgtgccgctctcgaaacacgcgggctgggacgaggtgaaggagttc
tcgcaggccgtcgcgcaacacatggcgagcacgctgcccaagtacttcagcgcgaagatg
ggcgcgcagaatcgcaagcagaagattttcgtcgactatctgcgcaataaccgcggctcg
agtaccgtcgccgcgttttcggtgcgggcgcgtcccggcctcggcgtttcggttccgctt
gcttgggacgaagtcgcgcaaacgacgggcggcgaccagtggaatatcgagaacctgcac
gagcgcctcgacgaactgaagggagacccgtgggccgattatgcaaagacgcggcaacgc
attacggcggcgatgaggaagcgtctgagcggtgcgtag

DBGET integrated database retrieval system