KEGG   Burkholderia sp. HB1: AC233_09055Help
Entry
AC233_09055       CDS       T04094                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
buq  Burkholderia sp. HB1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ALE54847
UniProt: A0A0M4PDE3
LinkDB All DBs
Position
1:complement(2104146..2105570)
Genome map
AA seq 474 aa AA seqDB search
MKIYDKLHIDGNWIAPCGTGTIDVIDSGTEEVMGRIPEGVDADAESAIAAARVAFDGWAA
TPAAERGRYLERIAENLKARTDELAALIAGEVGMPLKLARAIQVGSPVYNWNAYAKLAGS
FQFEERVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVVLKPSEIAPLNAF
VLAEAIHEAGLPAGVFNLVSGYGPVVGEMLASHPSVDMVSFTGSTRAGKRVSELASATIK
RVALELGGKSASVILDDADFAAAVKGTVGACFLNSGQTCSAHTRMLVPEARYDEACALAK
QAAESYAAGDPRDEKTRLGPLASAAQQARVQQYIAKGIEEGAELVTGGAGLPDGVSKGFF
VKPTVFGRVHPKATIAQEEIFGPVLSILTYKDEDEAIRIANDSPYGLGGAVWAGSDERAQ
RVARRIRTGQIDINGGAWNMAAPFGGFKQSGFGRENGVFGLEEYLELKSMQFNV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctacgacaaactccacatcgacggcaattggattgcgccgtgcggcacgggc
acgatcgacgtgatcgactccggcaccgaggaagtcatgggccgcatccccgagggcgtc
gacgccgatgcggaaagcgcgatcgcggccgcgcgcgtggccttcgacggctgggccgcc
acgcccgccgccgagcgcggccgatacctcgagcggatcgccgagaacctcaaggcgcgc
accgacgaactcgccgcgctgatcgcaggcgaagtcggcatgccgctgaagctcgcgcgc
gcgatccaggtcggcagtcccgtctacaactggaacgcctatgcgaagctcgcgggcagc
ttccagttcgaagaacgcgtcggcaattcgctcgtcgtgcgcgaaccggtcggcgtggtt
gcggcgatcacgccgtggaactatccgctcaatcagatcacgctgaaggtggcggccgcg
ctcgcggccggttgcacggtggtgctgaaaccgtcggagatcgcgcctttgaatgcgttc
gtgctggccgaagcgatccacgaagcggggctgcccgccggcgtgttcaacctcgtcagc
ggttatgggccggtggtcggcgaaatgctggcgagccatccatcggtcgatatggtgtcg
ttcaccggctcgacgcgcgccggcaagcgcgtgtcggaactggcatcggcgacgatcaag
cgggtcgcgctcgaactgggcggcaaatcggcatcggtcattctcgacgacgctgacttc
gccgccgccgtcaaaggcacggtcggcgcgtgcttcctcaattcggggcaaacctgttcg
gcgcacacgcgcatgctggtgcccgaagcgcgttacgacgaagcgtgcgcgctcgcgaaa
caggcggccgaaagctacgcggccggcgatccgcgcgacgagaaaacgcgccttggcccg
ctggcctccgccgcgcaacaggcgcgcgtgcagcagtacatcgcgaagggcatcgaggag
ggcgccgaactcgtgacgggcggcgcggggctgcccgacggtgtgtcgaaaggctttttc
gtcaagccgacggtgttcggccgcgtgcatccgaaagcgacgatcgcgcaagaagaaatc
ttcggcccggtgctgtccattctgacctacaaggacgaagacgaagcgattcggattgcc
aacgattcgccgtacggacttggcggcgcagtgtgggccggcagcgacgagcgcgcgcaa
cgcgtcgcgcgccgcatccgcacgggccagatcgacatcaacggcggcgcgtggaatatg
gcggcgccgttcggcggcttcaagcagtcgggcttcggacgcgagaacggcgtctttgga
ctcgaggaatatctcgaactcaagtcgatgcaattcaacgtctga

DBGET integrated database retrieval system