KEGG   Burkholderia sp. HB1: AC233_09430Help
Entry
AC233_09430       CDS       T04094                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00020  Citrate cycle (TCA cycle)
buq00310  Lysine degradation
buq00380  Tryptophan metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
buq01200  Carbon metabolism
Module
buq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC233_09430 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AC233_09430 (sucA)
   00380 Tryptophan metabolism
    AC233_09430 (sucA)
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AC233_09430 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALE54911
UniProt: A0A0M3TVF6
LinkDB All DBs
Position
1:complement(2189592..2192453)
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPENWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFIPRTAPGGEDLATARKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDQEFSATNLYFGFERASLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKEKLESIRSTPNFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIASMDEVVRHGGARGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDSGLQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTIAKHPGTRALYAEKLVQQGVITAEEGEEFVKAYRKAMDEGHHTVDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERITTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVIGEVDDTIDAKKVKRVLACSGRVYYD
LVAHRREAKANDVAIIRIEQLYPFAHKQFETEMKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatctgttcggcggcaatgctccgtacgtagaa
gaaatgtacgaagcatatctcgacaatccggcgtcagtgcccgagaactggcgcagctat
ttcgacgcgttgcagaatgttcctgcatcggacggcagcaatgccaacgacgtggcccac
ggcccgatcgtcgaatcgtttgcgcaacgggccaaggccaatgccttcatcccgcgcacc
gcacccggcggcgaagacctcgctaccgcgcgaaagcaagtctatgtgcagtccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgccgcgaa
cgtcccgcaatccccgaactcgaacccgcgttctacgacttcaccgaagccgacatggac
caggagttcagcgccacgaatctgtatttcggattcgagcgcgcgtcgctgcgtgagatc
gtcaaggcactgcgcgacacgtattgcggcacgatcggcgccgagtacatgtacatcagc
gatccggaacagaagcgctggtggaaggaaaagctggagtcgatccgctccacgccgaac
ttctcgaacgagaagaagaagcacatcctgaatcgcctgacggccgctgaaggcctcgag
cgcttcctgcacaccaaatacgtcggccagaagcgcttttcgctggaaggcggcgagagc
ttcatcgcgtcgatggacgaagtcgtgcgtcacggcggtgctcgcggcgtgcaggaaatc
gtcatcggcatggctcaccgtggccgtctgaacgtgctggtcaatacgctcggcaagatg
ccggctgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggcgac
gtcaagtaccacaagggtttctcgtcggacgtctcgaccgaaggcggcccggttcacctg
tcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcggcg
aaggcgcgtatggaccgtcgcggcgacgacagcggcctgcaagtgctgccggtgcagatc
cacggcgacgcggcttttgccggccagggcgtcgtgatggaaacgctgaacctcgcgcaa
acgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggtttc
acgacgtcggacccgcgcgattcgcgctccacgttgtactgctcggacgtcgtcaagatg
atcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtcgttctggccacg
caactggctatcgacttccgcatgcagttccacaaggatgtcgtggtcgacatcgtgtgt
ttccgcaagctgggtcacaacgagcaggacacgccggctgtcacgcagccgctgatgtac
aagaccatcgccaagcatccgggcacccgcgcgctgtacgcggaaaagctggtgcagcaa
ggcgtgatcacggcagaagaaggcgaggaattcgtcaaggcgtaccgcaaggcgatggac
gaaggccatcacacggtcgatccggtgctctcgaactacaagagcaagtacgcggtcgac
tgggtgccgttcctgaaccgcaagtggaccgacgcagccgacacggcagtcccgctcgcg
gaactgaagcgcctcgccgagcgcatcaccacgattccggaaaacttcaaggttcacccg
ctggtcgagcgcgtcatcaacgaccgtcgcgcgatgggccgtggcgaagcgaagctcgac
tggggcatgggcgagcatctcgcgttcgcgtcgctggtcgcatcgggttatgccgtgcgt
ctgacgggtcaggattcgggccgcggcacgttcacgcaccgtcacgcggtgctgcacgac
cagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaaggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctcggcttcgaa
tacggttactcgaccgctgaaccgaacacgttcgtcgcgtgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtgg
ggccgcgtgtcgggtctcaccatgctgctgccgcacggctacgaaggccagggtccggag
cactcgtcggcgcgtatcgagcgtttcctgcaactgtgcgcagaccacaacatgcaggtc
gttcagccgaccacgccggcgcagattttccacctgctgcgccgtcagatgatccgcctg
ttccgcaagccgctgatcgtcgccacgccgaaatcgctgctgcgtcacaaggaagcggtg
tcggacctgtcggaactcgcgaagggttcgttccagccggttatcggcgaagtggacgac
accatcgacgcgaagaaggtcaagcgcgtgctggcgtgctcgggccgcgtgtactacgac
ctcgtcgcgcatcgccgcgaagcgaaggcaaacgacgtcgcgatcatccgtatcgaacag
ctctatccgttcgcgcacaagcagttcgaaacggaaatgaagaagtacgacaacgcgacg
gaagtggtgtgggtccaggacgagccgcagaatcagggcccgtggttctacatcgagcat
cacctgaaggaaggcatgaaggaaggacagaagctggcatacagcggccgtccggcttcg
gcttcgccggcagtgggctactacgcgaagcactacgagcagcagaaggcgctggtcgaa
ggcgctttcggccgcctcaagagcgcgtcgatcgctaaataa

DBGET integrated database retrieval system