KEGG   Burkholderia sp. HB1: AC233_09845Help
Entry
AC233_09845       CDS       T04094                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00061  Fatty acid biosynthesis
buq00780  Biotin metabolism
buq01100  Metabolic pathways
buq01212  Fatty acid metabolism
Module
buq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AC233_09845 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AC233_09845 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:buq01004]
    AC233_09845 (fabZ)
Enzymes [BR:buq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AC233_09845 (fabZ)
Lipid biosynthesis proteins [BR:buq01004]
 Fatty acid synthase
  Component type
   AC233_09845 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ALE54978
UniProt: A0A0M5LK83
LinkDB All DBs
Position
1:complement(2293002..2293466)
Genome map
AA seq 154 aa AA seqDB search
MSTEKINLDIHKILTLLPHRYPILLVDRVLELEPHKSIKALKNVSINEPYFQGHFPTRPV
MPGVLILEALAQTAALLTFSEEPSDPSNTLYLFVGIDNARFKRVVEPGDQLILNCTFERH
MRGIWKFKARAEVDGVVAAEADLMCAVRHTDKDA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaaaaaatcaatctcgacatccataagattctcacgctgctgccccatcgt
tacccgatcctgctggtcgaccgggtgctcgaactcgagccgcacaagagcatcaaagcg
ttgaagaacgtgtcgatcaacgagccgtatttccaggggcatttcccgacgcgtccggtc
atgcctggcgtactgatcctcgaagcgcttgcgcaaacggcggcgctgctgacgttctcg
gaagagccgagcgatccgtcgaacacgctgtatctgtttgtcggtatcgacaacgcgcgc
ttcaagcgtgtcgtcgagccgggcgatcagctcatcctgaactgcacgttcgaacggcat
atgcgcggcatctggaagttcaaggcgcgggccgaggtggacggcgtggtggcggctgaa
gccgacctgatgtgcgcggtgcgtcacacggacaaggacgcctga

DBGET integrated database retrieval system