KEGG   Burkholderia sp. HB1: AC233_13125Help
Entry
AC233_13125       CDS       T04094                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00630  Glyoxylate and dicarboxylate metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AC233_13125
Enzymes [BR:buq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     AC233_13125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_3 Hydrolase_6 S6PP PriA_C
Motif
Other DBs
NCBI-ProteinID: ALE55506
UniProt: A0A0M4P200
LinkDB All DBs
Position
1:complement(3038100..3038759)
Genome map
AA seq 219 aa AA seqDB search
MAREQFDLIVFDWDGTLMDSTAHITRSIQAACRDLGLPVPADEAASYVIGLGLRDALQIA
APTLDPADYPRLAERYRFHYLVKDQTTELFAGVREMLQELRDQGYLLAVATGKSRVGLNR
ALDQVRLTSLFDGTRCADETFSKPHPAMLHELTRELGQDPVRTVMVGDTTHDLQMAINAG
VAGIGVTYGAHPADSLSALSPKYMASSISALSGWLKDNA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctagagagcaatttgacctgatcgtcttcgactgggacgggacgctgatggattcg
actgcgcacatcacgcgcagcattcaggcggcgtgccgcgatctcggtttgcccgtgccc
gcggacgaagcggcgagctatgtgatcggcctcggcctgcgcgacgcgctgcagatcgcc
gcgcccacgctcgatccggccgactacccgcggctcgccgagcgctaccggtttcactat
ctggtgaaggatcagaccacggagttgttcgccggcgtgcgcgagatgctccaggaactg
cgcgatcagggctatctgctggcggtcgcgaccggcaaaagccgcgtcggcctgaatcgt
gcgctcgatcaggtgcggctcacgagcctgttcgacggtacgcgctgcgcggacgaaacc
ttctccaagccgcatccggccatgttgcacgaactgacgcgtgaactggggcaggacccg
gtgcgcacggtcatggtcggcgatacgacacatgacctgcagatggcgatcaacgcgggc
gtcgcgggtatcggcgtgacctacggcgcgcatccggcggactcgctgagcgcgctgtcg
ccgaaatatatggcgtcgagcatcagcgcgctgtcgggctggctgaaggacaacgcatga

DBGET integrated database retrieval system