KEGG   Burkholderia sp. HB1: AC233_14340Help
Entry
AC233_14340       CDS       T04094                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00020  Citrate cycle (TCA cycle)
buq00480  Glutathione metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
buq01200  Carbon metabolism
buq01210  2-Oxocarboxylic acid metabolism
buq01230  Biosynthesis of amino acids
Module
buq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC233_14340
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AC233_14340
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AC233_14340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALE55711
UniProt: A0A0M3TVW7
LinkDB All DBs
Position
1:complement(3288262..3289518)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPTGGDKITVNADFSLNVSDQPIIPYIEGDGTGLDITPVMIKVVDAAVEKAYA
GKKKIHWMEIYAGEKSTRVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWPAESEQAKKVIKF
LQEEMGVKKIRFPDTSGIGIKPVSREGTERLVRKAIQYAIDNDRRSVTLVHKGNIMKYTE
GAFRDYGYALAQKEFNAELIDGGPWMKVKNPKTGGDIVVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWLEAADLIIKSMETSILQKRVTYDFARLMEGATQVSCSGFGQVMIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccgaccggtggtgacaagatcaccgtcaatgcggat
ttctcgctcaacgtttcggatcagccgatcattccgtatatcgaaggcgacggcaccggc
ctcgacatcacgccggtcatgatcaaggtcgtggacgcagcggtcgagaaggcttacgcg
ggcaagaagaaaatccactggatggagatctacgcgggcgagaaatcgacgcgagtgtac
gggccggacgtgtggctgcctgaagaaacgctgcaggtgctgaaggaatatgtggtgtcg
atcaagggaccgctcaccacgcccgtcggcggcggcatccgttcgctgaacgtcgcgctg
cgtcaggaactcgatttgtacgtatgcctgcgtccggtgcagtatttcaagggcgtgcct
tcgccggtgcgtgagccggaaaagaccaacatggtgatcttccgcgagaactccgaagat
atctacgcgggcatcgaatggccggccgaatccgagcaggcaaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaaaatccgcttcccggatacgtcgggcatcggcatc
aagccggtctcgcgcgagggcacggagcgtctcgtgcgcaaggcgattcagtatgcgatc
gacaacgaccgccgctcggtcacgctcgtgcacaagggcaacatcatgaagtacacggaa
ggcgcgttccgtgattatggttatgcgctcgcgcagaaggagttcaacgcggagctgatc
gacggcggcccgtggatgaaggtcaagaatccgaagacgggcggcgacatcgtcgtcaag
gatgtgatcgccgacgctttcctgcagcagattctgttgcgccccgccgaatacgacgtc
atcgccacgctcaatctgaacggcgactacgtgtctgacgcgctggccgcgcaagtgggc
ggcatcggcatcgcgccgggcgcgaacatgtcggattcggtcgcgatgttcgaggccact
cacggtacggcgcccaagtacgcgggcaaagactacgtgaatccgggctcggaaattctc
tcggcggaaatgatgctgcgccatctcggctggctcgaggcggcggatctgattatcaag
tcgatggaaacgtcgattctgcaaaagcgcgtcacgtacgacttcgcgcgtttgatggaa
ggcgcgacgcaggtgtcatgttcggggttcgggcaggtgatgatcgagaatatgtag

DBGET integrated database retrieval system