KEGG   Burkholderia sp. HB1: AC233_15080Help
Entry
AC233_15080       CDS       T04094                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00564  Glycerophospholipid metabolism
buq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AC233_15080
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AC233_15080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 3HCDH_N Pyr_redox_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ALE55844
UniProt: A0A0M4NZL3
LinkDB All DBs
Position
1:3447876..3449405
Genome map
AA seq 509 aa AA seqDB search
MTQGTKYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLAAHTSSASTKLIHGGLRYLE
YREFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPDLRPAWLIRAGLFLYDHLARRELL
PGSRGIVMRDHPAGAPLVESIKRGFVYSDGWVNDARLVVLNALDAAEHGAKILTRTKLLS
AVRAGGEWRAQLRRADGTTLDVRAASIANAAGPWVGELLQGALGRAASHSVRLVKGSHIV
TRRLFEHDHAYIFQNPDKRIIFAIPYEHDYTLIGTTDIEYRGDPAQVAITADETQYLCDS
INRYFRQKISPADVRWTYSGVRPLLEEEGADNPSAVTRDYSLELDAPAGEAPLLSVFGGK
ITTFRKLAEEAVDKLAAALGKGAPSWTAGASLPGGDIAHANFERFLAELKQHYAWLPDDL
AHRLARAYGTRVTKVIGHAHSLADLGHAFAPGLYEAELTYLRDVEWARSAQDVLWRRSKL
GLHVEPGTLDAITRDIDAWFAHEPERQRA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggcacgaaatacgatttgctcgtcgtgggcggcgggatcaacggcgcgggc
atcgcgcgcgacgcggccggccgcggactgtccgtgctgctttgcgaacaggacgacctc
gcggcgcatacatcgtccgcgagcaccaagctgattcacggcggcttgcgctatctcgag
taccgcgagttcgggctcgtgcgcaaagccctgcaggaacgcgagaccttgctgcgcgcc
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgcccgatctgcgcccg
gcctggctgatccgcgcgggcctctttctttacgatcacctcgcacggcgcgagctgctt
ccgggctcgcgcggcatcgtgatgcgcgatcatccggccggcgcgccgctcgtcgaatcg
atcaagcgcggcttcgtgtactcggacggctgggtcaacgacgcgcgcctcgtcgtgctg
aacgcgctagacgccgccgagcacggcgcgaagattctcacgcgcacgaagctgctgagc
gcggtgcgcgccggcggcgaatggcgcgcgcaactcaggcgcgcggacggcacgaccctc
gacgtgcgtgccgcgtcgatcgccaacgccgccggcccgtgggtcggcgaactgctgcaa
ggcgcgctgggccgcgcggcgtcgcacagcgtgcggctcgtcaaaggcagccacatcgtc
acgcggcggctgttcgagcacgaccacgcgtacattttccagaacccggacaagcggatc
atcttcgcgattccgtacgagcacgactacacgctgatcggcacgaccgacatcgaatat
cgcggcgaccccgcgcaggtcgcgatcaccgccgacgagacgcagtacctgtgcgactcc
atcaaccgctatttcaggcagaaaatttcgccggccgacgtgcgctggacctactcgggc
gtgcggccgctgctcgaagaagaaggcgccgacaacccgtcggccgtcacgcgcgactac
tcgctcgaactcgacgcgcccgcgggcgaagcgccgctgctatcggtgttcggcggcaag
atcacgacgttccgcaagcttgcggaagaagccgtcgacaaactcgcggccgcgctcggc
aaaggtgcgccgtcgtggacggccggcgcgtcgttacccggcggcgatattgcgcatgcg
aacttcgagcgcttcctcgccgagctgaagcagcattacgcatggttgcccgacgatctc
gcgcatcgcctcgcgcgcgcttacggcacgcgtgtgacgaaggtgatcggccatgcgcat
tcgctcgccgatctcggccacgcgttcgcgcctggtctttacgaggccgagctgacttat
ctgcgcgacgtcgaatgggcgcgcagcgcgcaggacgtcctctggcgccgctcgaaactc
ggccttcacgtcgagccgggcacgctcgacgcgatcacgcgcgacatcgacgcatggttc
gcacacgaacccgagcgacagcgcgcgtaa

DBGET integrated database retrieval system