KEGG   Burkholderia sp. HB1: AC233_15780Help
Entry
AC233_15780       CDS       T04094                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00473  D-Alanine metabolism
buq00550  Peptidoglycan biosynthesis
buq01100  Metabolic pathways
buq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AC233_15780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AC233_15780
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AC233_15780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buq01011]
    AC233_15780
Enzymes [BR:buq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AC233_15780
Peptidoglycan biosynthesis and degradation proteins [BR:buq01011]
 Precursor biosynthesis
  Amino acid ligase
   AC233_15780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: ALE55967
UniProt: A0A0M4PU54
LinkDB All DBs
Position
1:complement(3606095..3607036)
Genome map
AA seq 313 aa AA seqDB search
MSSIDPKKFGKVAVLLGGNSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAERPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIKYTGSGVLGSALGLDKFRTKLVWQQLGIPTPP
FEAVLRGDDYEARAQEIVAKLGLPLFVKPASEGSSVAVIKVKSADALPAALVEAVKYDRI
VVVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYIANDTQYLIPCGLTPAEET
RMKVLARRAFDVLGCTDWGRADFMLDADGNPYFLEVNTAPGMTDHSLPPKAARAVGISYQ
ELVVGVLALTLKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtatcgacccgaaaaaatttggcaaggtggccgtgctgctcggcggcaattcg
gccgagcgcgaagtgtcgctcaattccgggcgcctcgtgctgcaaggtctgcgcgacgcc
ggcatcgacgcgcatccgttcgatccggccgagcgtccgctcgccgcgttgaaggacgaa
ggcttcgtgcgcgccttcaatgcgctgcatggcggctacggcgaaaacggccagattcag
ggcgcgctcgatttttacggcatcaagtacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaaattccgcaccaagctcgtgtggcagcagctcggcattccgacgccgccg
ttcgaagccgtgctgcgcggcgacgactacgaagcgcgcgcgcaggagatcgtcgcgaag
ctcggcttgccgctcttcgtgaagccggcgagcgaagggtcgagcgtcgcggtcatcaag
gtgaagagcgcggacgcgttgcctgcggcgctcgtcgaagcggtgaagtacgacaggatc
gtggtggtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgcaggcgat
ctggacctgccggtgatccgcatcgtaccggccggcgagttctacgactaccacgcgaag
tacatcgcgaacgacacgcagtatctgattccgtgcggcctcacgcccgccgaagagacg
cgcatgaaagtgctggcgcgccgcgcgttcgacgtgctcggctgcaccgactggggccgc
gccgatttcatgctcgacgcggacggcaacccgtacttcctcgaagtgaacacggcgccc
ggcatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtgggcatcagctatcag
gaactggtggtcggcgtgttggcgctgaccttgaaggattga

DBGET integrated database retrieval system