KEGG   Burkholderia sp. HB1: AC233_20560Help
Entry
AC233_20560       CDS       T04094                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buq  Burkholderia sp. HB1
Brite
KEGG Orthology (KO) [BR:buq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AC233_20560
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AC233_20560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin K_oxygenase Thi4 FAD_oxidored FAD_binding_3 DAO NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ALE56874
LinkDB All DBs
Position
2:complement(118555..120147)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKTYLEKVSNPIEIVASLDDSAKSQELLALLNDIATLSERVTVIERRGDSE
RKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINE
VRLANGAVLKARTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLFEFGATLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGEVKKVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEETEAVSEVEAEATV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagactcagttgaaaacgtacctcgaaaaggttagtaaccct
atcgagatcgtcgcgtcgctcgacgacagcgcgaaatcgcaagagctgctggcattgctg
aacgatatcgcgacgttgtcggaacgcgttaccgtcatcgaacgccgcggcgacagcgaa
cgcaagccgtcgttctcgatcggcgagccgggcaaggacatcggcatccgtttcgcgggc
attccgatggggcatgaattcacgtcgctcgtgcttgcgttgctgcaggtcggcggccat
ccggtcaaactcgacgacgcggtgatcgaacagatccgcagtctcgacggcgactatcaa
ttcgaaacgtatttctcgctgtcatgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgttgatcaacccgcgcattcgccacgtggcgatcgacggcgcgctgttccag
aacgaagtcgaagcacgccagatcatggctgtgccgaccatgttcctgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgcgaagctcgacacgaatgccggc
gcgcgtgcagcgaaggaactggaaaacaagccggtgttcgacacgctgatcgtcggcggc
gggccggctggcgcggccgcggcgatctattcggcgcgcaagggcatcgcgacgggcgtc
gtcgcggaacgcttcggcggccaggtgctcgatacgctcgcgattgaaaacttcgtgtcc
gtcaccgagaccgaaggaccgaagttcgccaccgcgctcgagcagcacgtcaagacgtat
gaagtcgacatcatggacgtgcagcgcgccgaggcgctgattcccggccgcatcaacgaa
gtgcgtctcgcgaatggcgcggtgctgaaggccagaacgatcattctcgcgacgggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgcaatcacggcgtcgcgtac
tgcccgcactgcgatggcccgctcttcaagggcaagcgtgtcgcggtgatcggcggcggc
aactcgggcgtggaagcggccatcgacctcgcgggcatcgtgcgcgaagtgacgctgttc
gaattcggcgctacgttgcgtgccgacgaagtgctgcaacgcaagctgcgcagcctcgcc
aacgtgaccatcgtcacccaggcgcagaccacggaaatcaccggcgacggcaagaaggtc
aacggtctcgtctacaaggatctgcgttcgggcgaagtgaagaaggttgagctggaaggc
gtgttcgtgcagatcggtctcgtgccgaacaccgaatggctgaagggcacagtcgagttg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgccgggcgtgttc
gcagccggcgacgtgaccacggtgccgttcaagcagatcgtgattgcggtcggcgagggc
gcgaaggcatcgctcagcgcgttcgatcatctgatccgcaacagcgaggaaacggaagcg
gttagcgaggtggaagccgaagcgacggtttga

DBGET integrated database retrieval system