KEGG   Burkholderia sp. HB1: AC233_22105Help
Entry
AC233_22105       CDS       T04094                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00630  Glyoxylate and dicarboxylate metabolism
buq00710  Carbon fixation in photosynthetic organisms
buq01100  Metabolic pathways
buq01120  Microbial metabolism in diverse environments
buq01200  Carbon metabolism
Module
buq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AC233_22105
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AC233_22105
Enzymes [BR:buq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AC233_22105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ALE57179
UniProt: A0A0M4PWB6
LinkDB All DBs
Position
2:complement(467659..468087)
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEIGLQIDYALSQGWACSVEFTDDPHPRNTYWEMWGLPMFDLHD
AAGVLQEVKACRAARPDHYIKVNAFDSVRGFETMRLSFIVNRPDHEPGFRLTRQDGPGRL
QHYGLAGYASDRPSGERYGTEH
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattacacagggcacgttctccttcctgcctgaattgaccgacgaggaaatcggc
ttgcagatcgactatgcattgagccagggctgggcctgttccgtcgaattcaccgacgac
ccgcatccgcgcaatacgtattgggaaatgtggggtctgccgatgttcgacctgcacgat
gcagccggcgtgctgcaggaagtaaaagcgtgccgcgcggcaaggcccgatcattacatc
aaggtcaatgcgttcgattcggtgcgcggcttcgaaacgatgcgcctgtcgttcatcgtc
aatcgtcccgatcatgagccgggcttccgtctgacgcgtcaggacgggccaggacgcttg
caacactacggccttgcaggctatgcgagcgaccggccttcgggcgaacgctacggcacg
gagcattga

DBGET integrated database retrieval system