KEGG   Burkholderia sp. HB1: AC233_24010Help
Entry
AC233_24010       CDS       T04094                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00440  Phosphonate and phosphinate metabolism
buq01100  Metabolic pathways
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AC233_24010
Enzymes [BR:buq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AC233_24010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7 YfdX
Motif
Other DBs
NCBI-ProteinID: ALE57556
UniProt: A0A0M4P5M2
LinkDB All DBs
Position
2:complement(883319..885043)
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSSSRSARLRQMLVSSELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMEEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAQEIHTSQTLVNVEDRIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGAAVVLAASRGKGLEAVTEDRPKVMLPVAGKPLLRWLVDAFKKQGVNHITVVGGYR
ADAIDTAGIKLVVNDKHEQTGELASLACALDKLSGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSASDDRGLFGNKVVLRHVSSGQEASAAIAAQTPHGRW
VGLLNVRGAGRERLQTVMAQLQARADFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGGAASDAAGGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgccttcgtctcttcttcacgcagcgcacgtctgcgccagatg
cttgtcagcagcgaactcgaattcatgatggaggcgcataacggcctctccgcgcgcatc
gtccgcgaagccggcttcaaggcgatctggggctcgggcctcgcgatctccgcgcaattc
ggcgtgcgcgacaacaacgaggcaagctggacccaggtcgtcgacaacctcgaattcatg
gccgacgcaagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccgccttgtgcgcaagctcgaacaacgcggcatcgccggcgtgtgcatcgaa
gacaagcagttcccgaagaccaatagcttcatcaacggcgaggcgcagccgcttgccgac
atcgacgaattctgcggcaagatcaaggccggcaaggactcgcaatcggacgagaatttt
tcgatcgtcgcgcgcgtggaagcgctgattgccggctggggcatggaagaagcgctgcgc
cgcgcggaagcctaccgccgcgccggcgccgacgcgatcctgattcacagcaagctctcg
cgccccgacgaaattctcgagttcgcgcgcgagtgggcgggccgcgggccgctcgtgatc
gtgccgaccaagtactacagcacgccgaccgaagtgttccgcgaagccggcatcagcacc
gtgatctgggcgaaccatctgattcgcgcggccacgtcggcgatgcaggcggtcgcacaa
gaaatccacacgagccaaacgctcgtcaacgtggaagaccgcatcgccgcggtcaacgaa
attttccgtttgcaggacgccgacgagtattcggaagcggaagaccgctatctgtcgagc
ggccgcgcggcgggcgccgcggtcgtgctcgcggcgagccgcggcaagggcctcgaggcc
gtcaccgaagaccgtccgaaagtcatgctgccggttgcgggcaagccgctgttgcgctgg
ctcgtcgacgcgttcaagaagcagggcgtcaaccacatcacggtggtcggcggttatcgc
gccgatgcaatcgatacggcaggcatcaagctcgtcgtcaatgacaagcacgagcagacc
ggcgaactcgcgtcgctcgcgtgcgcgctcgacaagctctcgggtgacaccgtgatctcg
tacggcgatctgctgttccgcagctacatcctgcgcgatctggtggagagcgaggcggcc
ttcagcgtggtcgtcgattcttcgctgaccgatgcggaaaacgccagcgtgcgcgacttc
gcgtggtgctcggcttccgacgaccgcggcctgttcggcaacaaggtcgtattgcgccat
gtgtcgagcggacaggaggcgtcggcggcgatcgccgcacaaacgccgcatggccgctgg
gtcggtttgctcaacgtgcgcggcgcaggccgcgagcgtctgcagacggtgatggcgcaa
ttgcaggcgcgcgccgactttgcatcgctcgacatgcccgcgttgctgaacgcgctgatc
gaagcaggcgagtcgatcgaagtgcaatacgtgcacggccattggcgcggcgtcaacgat
ctcgaagacttccgccgcgccggcgacttcgcgcacggacagacgccgctcgcggcatcg
gtcggcggtgcggcctccgacgcagcgggcggggcggcgcaatga

DBGET integrated database retrieval system