KEGG   Burkholderia sp. HB1: AC233_24020Help
Entry
AC233_24020       CDS       T04094                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00550  Peptidoglycan biosynthesis
buq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AC233_24020
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AC233_24020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buq01011]
    AC233_24020
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:buq03036]
    AC233_24020
Enzymes [BR:buq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AC233_24020
Peptidoglycan biosynthesis and degradation proteins [BR:buq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AC233_24020
Chromosome and associated proteins [BR:buq03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AC233_24020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer LigD_N
Motif
Other DBs
NCBI-ProteinID: ALE57558
UniProt: A0A0M4NQ51
LinkDB All DBs
Position
2:887378..889147
Genome map
AA seq 589 aa AA seqDB search
MIPKKKSPSRDSYAPVAKNQLLVARLPMWRSKFIVVLVFAAFAALAGRAFWVQVVNRDFY
VDQGQKRYQRTIELDATRGRIVDRNGSMLAVSLATYEIWATPKLLDEAALPPLSKLLDLP
LAELRRRLNGDKTFVLLKRQVDADTAGHLSKLGLAGITQIADSKRFYPEGESAAHVVGFT
DIEDNGQEGVELAANEHLLGVPGHREVIRDRLGRVVSETRPLVPAQNGDTIHLTIDRRIQ
QLAYAQLKDAIAKHRAEAGSVVVLDARNGEILALANYPSFDPNDRARLTGRQLRNRAVVD
TFEPGSTIKPVVVALSIDEGKVRPQSVIDTAPGWYKIGPAVIHDTSNHGAMTVAEAVQKS
SNIALAKLALNLPAEKIWAKYQEYGLGMRPELTFPGVASGKVRPYKRWRPIEQATMAYGY
GLSASLLQIAQIYTAYAGDGTMHPVRLVRENIDAAAAASQTGHAVTTPATARAIRSMLEM
ATGDGGTGRAATVEGYRIGGKTGTARKQVGASYAKNRYRALFVGMAPMSDPRLIVAVMID
DPAGKAFYGGTVAGPVFSAVTGGSLQLLGVPPDARGVDGQNAAHAFAPS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgaagaaaaaatccccgtcgcgcgattcttatgcgcccgtcgcgaagaaccag
ttgctggttgcgcgtctgccgatgtggcgctcgaagttcatcgtcgtgctggtgttcgcc
gcgtttgccgcgctcgcgggccgcgcgttctgggtgcaggtggtgaaccgcgacttctat
gtcgatcaggggcaaaagcgctatcaacgcaccatcgaactcgacgcgacgcgtgggcgc
attgtcgaccgcaatggctcgatgctcgccgtcagtctcgcgacttacgagatctgggca
acgccgaagctgctcgacgaagccgcgctgccgccgctttcgaaactgctcgatctgccg
ctcgcggaactgcgccgccgtttgaacggcgacaagaccttcgtgctgctcaaacgccag
gtggacgcggacacggccgggcatctgtccaagctcggactcgcgggcatcacgcagatc
gcggattcaaagcgtttctatccggaaggcgaatcggcggctcacgtggtcggctttacg
gacatcgaggacaacggccaggaaggcgtcgagcttgccgccaacgaacacttgctcggc
gtgccgggccatcgcgaagtgattcgcgaccggcttggccgcgtggtgtcggaaacgcgg
ccgctcgtgcccgcgcagaacggcgacacgattcatttgacaatcgatcggcgcatccag
cagctcgcgtatgcacagttaaaggacgccatcgcgaagcatcgcgcggaagccggcagc
gtggtcgtgctcgacgcgcgcaacggcgagattctcgcgcttgccaactatccgagcttc
gatccaaacgatcgcgcgcgcctcacgggccggcagttgcgcaatcgcgcggtggtggac
acgttcgagcccggctcgacgatcaagccggtggtcgtcgcgttgtccatcgacgagggc
aaggtgcggccgcaaagtgtgatcgacacggcgcctggctggtacaagatcggccccgcg
gtgatccacgacacgtcgaatcacggcgcgatgaccgtcgccgaagcagtgcagaaatcg
agcaatatcgcgctcgccaaactcgcgctcaatctgcccgccgaaaaaatctgggccaaa
tatcaggagtacggactcggcatgcggcccgagctgacctttccgggcgtggcgtcgggc
aaggtgcgtccgtacaaacgctggcgtcctatcgagcaggcgacgatggcttacggctat
gggctctcggcgtcgctgctgcagatcgcgcagatctacaccgcctatgccggcgacggc
accatgcatccggtgcgcctcgtgcgcgagaacatcgatgccgcggccgccgcttcgcaa
acgggccatgcggtcaccacgccggccaccgcgcgcgcgatccgttcgatgctcgaaatg
gccacgggcgacggcggcacggggcgcgctgcaaccgtcgaaggctatcgcatcggcggc
aagaccggcactgcgcgcaagcaggtcggcgcgtcttacgcgaagaaccgttatcgcgcg
ctcttcgtcggcatggcgccgatgagcgacccgcgcctgatcgtcgcggtgatgatcgac
gatccggccggcaaggcgttttatggcggcactgtcgcaggccccgtgttcagcgcggta
acgggcggctcactgcaactgctcggcgtgccgccggatgcgcgaggcgtcgacggacaa
aacgccgcacacgcatttgcgccgtcttaa

DBGET integrated database retrieval system