KEGG   Burkholderia sp. HB1: AC233_25060Help
Entry
AC233_25060       CDS       T04094                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00020  Citrate cycle (TCA cycle)
buq00190  Oxidative phosphorylation
buq00650  Butanoate metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
buq01200  Carbon metabolism
Module
buq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
buq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC233_25060
   00650 Butanoate metabolism
    AC233_25060
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AC233_25060
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AC233_25060
    1.3.5.4  fumarate reductase (quinol)
     AC233_25060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 Thi4 Pyr_redox_2 GIDA HI0933_like FAD_oxidored Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALE57757
UniProt: A0A0M4P2Y4
LinkDB All DBs
Position
2:1117845..1119620
Genome map
AA seq 591 aa AA seqDB search
MAAIKNALPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTARGHEEPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVKHVKEIKDHKPLPADAADFALSRLAKLESSSSGEYAQSVANDIRGTMQKHAGVFRTS
ALLSEGVEAIREVAARVDNIHLKDKSKVFNTARVEALEVANLIEVARATMVSAEARKESR
GAHAQNDFEHRDDENWLRHTLWFSEGDRLDYKPVHMQPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaagaatgccctgccgcgtcgcaagttcgacgtggttatcgtcggcgcg
ggcggctcgggaatgcgcgcgtcgctgcaactggcgcgcgcgggtctgtcggtgtgtgtg
ctctcgaaagtgttccccacgcgctcgcatacggtcgccgcgcaaggcggcatcggcgcg
tcgctcggcaacatgagcgaggacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagcaccgaacgcc
gtctacgaactcgaacacttcggcatgccgttcgaccgtaacgcggacggcacgatctac
cagcgcccgttcggcggccacacggcgaactacggcgagaagcccgtgcagcgcgcgtgc
gccgcggctgaccgcaccggccacgcgctgctgcatacgctgtatcagcagaacgttgcg
gcgaagacgcagttcttcgtcgaatggatggcgctcgatctgatccgcgacgccgacggc
gacgtgctcggcgtgaccgcgctcgaaatggaaacgggcgacgtctatatcctcgaaggc
aagacgacgctgttcgccacgggcggcgcgggccgcatcttcgcggcatcgacgaacgcg
ttcatcaataccggcgacggcctcggcatggccgcgcgctcgggcatcgcgctgcaggac
atggagttctggcagttccacccgacgggcgtggcgggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcattctgcgtaactcggacggcgagcgcttcatggagcgt
tacgcgccgacgctgaaggatctcgcgccgcgcgacttcgtttcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtcggtccgaacaaggaccacgtgctgctggacctgtcg
cacatcggcgcggagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgccaacgtcgactgcatcaaggaaccgatccccgttgtgccgaccattcactaccag
atgggcggcattccgacgaacatccacggtcaggtggtcggcacggcgcgcggtcacgag
gagccggtgaacggcttctacgcggtcggcgaatgctcgtgcgtgtcggtgcacggcgcg
aaccgcctgggcacgaactcgctgctcgacctggtggtgtttggccgcgcggcgggcaat
cacatcgtcaagcatgtgaaggaaatcaaggaccacaagccgctgccggcggacgctgct
gacttcgcgctgtcgcgtctggcgaagctcgaaagctcgtcgtcgggcgagtacgcgcag
tcggtggcgaacgacatccgcggcacgatgcagaagcacgcgggcgtgttccgcacgtcg
gcgctgctgtccgaaggcgtcgaggcgatccgcgaagtggcggcgcgtgtggacaatatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaggcgctggaagtggcg
aacctgatcgaagtggcgcgcgcgacgatggtctcggccgaagcacgcaaggaaagccgc
ggcgcgcatgcgcagaacgacttcgagcatcgcgacgacgaaaactggctgcgccatacg
ttgtggttcagcgagggcgaccgcctcgactacaagccggtgcacatgcagccgctgacg
gttgaatcggtgccgcccaaggcgcggaccttctaa

DBGET integrated database retrieval system