KEGG   Burkholderia sp. HB1: AC233_25065Help
Entry
AC233_25065       CDS       T04094                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00020  Citrate cycle (TCA cycle)
buq00190  Oxidative phosphorylation
buq00650  Butanoate metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
buq01200  Carbon metabolism
Module
buq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
buq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC233_25065 (sdhB)
   00650 Butanoate metabolism
    AC233_25065 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AC233_25065 (sdhB)
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AC233_25065 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AC233_25065 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4 Fer2
Motif
Other DBs
NCBI-ProteinID: ALE57758
UniProt: A0A0M4NQH5
LinkDB All DBs
Position
2:1119639..1120343
Genome map
AA seq 234 aa AA seqDB search
MAKRTFEIYRYDPDRDAAPRMQTYEIEIDSHERMLLDALVKLKALDETLSFRRSCREGVC
GSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIKPYLIN
DTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtacatttgaaatctaccgctacgatccggacagggacgcagcgccgcgc
atgcagacgtacgagatcgagatcgactcgcacgagcgcatgctgctcgacgcgctggtg
aagctcaaggcgctcgacgaaacgctgtcgttccgccgttcgtgccgcgaaggcgtgtgc
ggctcggacgcgatgaacatcaacggcaagaacggtctggcgtgtctgacgaacctgaac
gacctgccgcagaagatcgtgctgcgtccgctgccgggactgccggtggtgcgcgacctg
atctgcgacttcacgcagttcttcaaccagtatcactcgatcaagccgtacctgatcaac
gacacgccgccgccggagaaggagcgtctgcagtcgccggaagaacgcgacgagctcgac
ggtctgtatgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtgg
aatccggacaagttcgtgggtccggcgggtctgttgcaggcttatcgttttatcgcggat
agccgtgatgaggcgaccggcgagcgtttggataatctggaagatccgtaccgtctgttc
cgttgccacacgatcatgaactgcgtcgacgtctgcccgaaggggctgaacccgacgaag
gcgattggcaagatcaaggaattgatggttcgccgcactgtctga

DBGET integrated database retrieval system