KEGG   Burkholderia sp. HB1: AC233_25330Help
Entry
AC233_25330       CDS       T04094                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00500  Starch and sucrose metabolism
buq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AC233_25330
Enzymes [BR:buq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AC233_25330
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AC233_25330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ALE57810
UniProt: A0A0M5LN79
LinkDB All DBs
Position
2:1174546..1178007
Genome map
AA seq 1153 aa AA seqDB search
MKRDDPSQAASQAHASTATASATNARTRRRGKPAALSDDPLWYKDAIIYQVHIKSFFDAN
NDGVGDFPGLIAKLDYIAELGVNAIWLLPFYPSPRRDDGYDIADYRNVHPDYGQLSDVKR
FIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNFYVWSDTDQKYQETRIIF
IDSEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLREVLQIMRFWLDMGIDGLRLDAV
PYLVEREGTNNENLPETHEVLKKIRATIDAEYPNRMLLAEANQWPEDVKEYFGDEDECHM
AFHFPLMPRIYMSIASEDRFPITDIMRQTPDLAPSNQWAIFLRNHDELTLEMVTDSERDY
LWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDNI
HLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGSLYGFDAVNVEAQSRDPHSLLNW
TRRMLATRRAKQTFGRGTIRFLKPENRKILAYLRELPGEPPILCVANLSRAPQAVELDLS
EFNGAVPIEMTADSVFPAIGQLTYLLTFPPYGFLWFLLCEGGQRPTWAQAHPEPLPEFVT
IVIREGQAGPTPENVRLLESEVLPSWLSRRRWFASKDQKMHAVRLAALTTIPNGGFAFTE
IEADVGKHTERYVVPIAITWGGETTTPLFLQLALARVRRGRNVGHLTDAFALPIFAHGVL
RKLRERAVVPTVQKSEIRFIPTDRFAELDNLGERPEIRWLAAEQSNSSLIIADAAVLKLV
RRLVSGIHPEAEISRYLTQLGYANTAPLFGEVVRVDPEGVPHTLAIVQGFVDNQGDAWNW
SLDYLRRSVDELAITIDTEASSAPDRGNEAILLEGYAALAGIIGRRLGELHVALASPTDD
PAFAPEPTSAEQVKAWVDGTQSMLASALDLLAPRIDQLLDADTKALAQSLIDRRAALVEA
VDKLIAPDTQALRIRIHGDFHLGQVLVAQGDAYLIDFEGEPARSLEERRQKSSPLRDVAG
LMRSLSYASAAAQSTTEAAPQQTADRKRALFDRFRAEATNVFLKEYRAATAEAPTPLVAP
EAEQALLDLFLIEKAAYEIRYEAANRPTWLSLPVRGLAALASRLLGDTGAPHDSSTQAPD
AATPPHPAEGDHE
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgacgatccctctcaggccgcgtcgcaagcccatgcgagcacggcgaccgcc
agcgcaaccaacgcgcgcacgcgtcgccgcggcaagccggcagcgctcagcgacgatccg
ctctggtacaaggacgcgatcatttatcaggtgcacatcaagtcgttcttcgatgcgaat
aacgacggcgtcggcgattttcccggcctgatcgcgaagctcgactacatcgccgaactc
ggtgtgaatgcgatctggctgctgccgttctatccgtcgccgcgccgcgacgacggctac
gacatcgccgattaccgcaacgtgcatccggactacggccagctctccgacgtcaagcgc
ttcattcaggaagcgcacgcgcgcggcatccgcgtgattaccgaactggtaattaaccac
acgtcggaccagcacccgtggtttcagcgcgcgcgccgcgcgaagccaggctcgaatcat
cgcaacttctatgtgtggtccgataccgatcagaagtatcaggaaacgcgcattatcttt
atcgactccgagccttcgaactggacacacgatccggtcgcgggcgcgtactactggcat
cgcttttactcgcatcagcccgatctgaacttcgacaatcccgcggtgctgcgcgaggtg
ttgcagatcatgcgcttctggctcgatatgggcatcgacgggctgcgtctggacgcggtg
ccgtatctcgtcgaacgcgaaggcacgaacaacgagaacctgcccgaaacgcacgaagtg
ctgaagaagattcgcgcgaccatcgacgccgagtatccgaaccgcatgctgcttgccgaa
gccaaccagtggccggaagacgtgaaggaatatttcggcgacgaagacgaatgccacatg
gccttccacttcccgctgatgccgcgcatctacatgtcgattgcgagcgaggaccgcttt
ccgatcaccgacatcatgcggcaaacgccggacctcgcgccgtcgaatcaatgggcgatt
ttcctgcgcaatcacgacgagctcacgctcgaaatggtcacggattccgagcgcgactac
ttgtggaacacctacgcaagcgatcgccgcgcgcgcctgaatctcggcattcgccgccgt
ctcgcgccgctgatggagcgcgaccgccgccgcatcgagctgatcaattcgctgctgctg
tcgatgcccggcacgcccgtgatctattacggcgacgagctcggcatgggcgacaacatt
cacctcggcgatcgcgacggcgtgcgcacgccgatgcaatggtcgtcggatcgcaacggc
ggtttctcgcgcgccgatcccgagcaactcgtgctgccgccggtgatgggctcgctctac
ggctttgacgcggtgaacgtcgaagcgcaaagccgcgatccgcattcgctgctcaactgg
acgcggcgcatgctcgccacgcgtcgcgcgaaacaaacgttcgggcgcggcacgatccgt
ttcctgaagccggagaaccgcaagattctcgcgtatctgcgcgaattgcccggcgagccg
ccgattctttgcgtcgcgaatttgtcgcgtgcgccgcaagcggtggaactcgatctgtcg
gaattcaacggcgcggtgccgattgaaatgaccgccgattccgtgttccccgcgatcggt
caattgacttatctgctgaccttcccgccgtatggcttcctgtggttcctgctgtgtgaa
ggcggtcagcgtccgacgtgggcgcaggcgcatcccgagccattgccggaattcgtgacc
atcgtgatccgcgaaggccaggccggcccgacgcctgaaaacgtgcggctgctcgaatcg
gaagtgctgccttcgtggttgagccggcgccgctggtttgcatcgaaggatcaaaagatg
catgcggtgcggctcgccgcgttgaccacgatcccgaacggcggcttcgcgttcaccgaa
atcgaagcggacgtcggcaagcacacggaacgctacgtggtgccgatcgcgatcacgtgg
ggcggcgagacgacgacaccgctctttctccagcttgcgttggcgcgcgtacggcgcggc
cgcaacgtcgggcatctcaccgacgcgttcgcgctgccgatcttcgcgcacggcgtgctg
cgcaaattgcgcgaacgcgcggtcgtgccgaccgtgcaaaagagcgaaatcaggttcatt
ccaaccgaccgtttcgcggaactcgacaatctcggcgaacgccccgaaatccgctggctg
gctgccgagcaaagcaacagctcgctgatcattgccgatgccgcggtgctcaagctcgtg
cggcgtctcgtgagcggcattcatccggaagcggaaatcagccgctatctgacgcaactc
ggctatgcgaacacggcgccgctctttggcgaagtggtgcgcgtcgaccccgagggcgtg
ccgcatacgctcgcgatcgtgcaaggcttcgtcgacaaccagggcgatgcgtggaactgg
tcgctcgattatctgcgccgctccgtcgacgaactcgcgatcacgatcgatacggaagcg
tcgtctgcgcccgatcgcggcaacgaggcgattctgctcgaaggctacgcggcgttggcc
ggcatcatcggcagacggcttggcgagttgcacgtcgcgctcgcttcgccgaccgacgac
cccgcgttcgcccccgaaccgacgagcgccgagcaggtcaaggcgtgggtcgacggcacg
cagtcgatgctcgcgagcgcgctcgatctgctcgcgccgcgcatcgaccagttgctcgat
gcggacacgaaggcgctcgcgcaaagtctgatcgaccggcgcgcggcgctcgtcgaagct
gtcgacaagctcatcgcgccggacacgcaggcgctgcgcattcgcattcacggcgacttc
catctgggccaggtgctggtcgcgcagggcgacgcgtatctgatcgacttcgaaggcgag
cccgcgcgttcgctcgaagagcgtcggcagaagtcgagcccgctgcgcgatgtggccggc
ctgatgcgttcgctgtcgtatgcgagcgccgcggcgcagtccacgacggaagccgcgccg
caacagaccgcggaccgcaagcgcgcgctgttcgaccgtttccgcgcggaagccaccaac
gtcttcctgaaggaataccgcgcggccaccgccgaagcgccgacgccgctcgtcgcgccc
gaggcggagcaggcgctcctcgatctgttcctgatcgagaaggccgcgtatgaaatccgc
tacgaagcggccaaccgtccgacgtggctcagcttgccggtgcgaggccttgcggcgctc
gccagccggctgctcggcgacaccggcgcgccgcacgattcctcaacccaggcgccagac
gccgccacaccgcctcatccggccgagggcgatcatgagtga

DBGET integrated database retrieval system