KEGG   Burkholderia sp. HB1: AC233_26520Help
Entry
AC233_26520       CDS       T04094                                 

Definition
(GenBank) plasmid partitioning protein ParA
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00010  Glycolysis / Gluconeogenesis
buq00520  Amino sugar and nucleotide sugar metabolism
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01120  Microbial metabolism in diverse environments
buq01130  Biosynthesis of antibiotics
buq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AC233_26520
   00520 Amino sugar and nucleotide sugar metabolism
    AC233_26520
Enzymes [BR:buq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AC233_26520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Tex_YqgF FGGY_N Hexokinase_1 Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ALE58041
UniProt: A0A0M3TX84
LinkDB All DBs
Position
2:1449407..1450207
Genome map
AA seq 266 aa AA seqDB search
MAASKDKAATRNERILAIDVGGTGLKAAIIDANGQMQTERLRVATPHPCTPQQLVDALAK
LVEPLIAKAPAQLMSIGFPGVVRNNRILTAPHFGVEGWRDFALADLLAQKLGGLPARMIN
DAEMQGFAAIEGKGIEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKKGVAYDEYIGDA
AREKAGNKRWNKRVHKVIGILESLVNYDKLWIGGGNAARLTFDLPANVATVSNDAGIEGG
ARLWHPRSVRETRQLPEANARTGKFK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatcgaaagacaaggcagcaacgcgtaacgaacggattcttgcaatcgacgtc
ggcggcactggactgaaagcggcgatcatcgacgcaaacggtcagatgcaaaccgagcgc
ttgcgcgtggcgacgccgcatccgtgcacgccgcagcaactcgtcgatgcgttggcaaaa
ctcgtcgagccattgatcgcgaaggcgccggcgcagttgatgtcgatcggctttcccggc
gtggtccgcaacaaccgcattctgaccgcgccgcatttcggcgtggaaggatggcgcgac
tttgcgcttgccgatctgctcgcgcaaaaactgggcggcttgcccgcgcgcatgatcaac
gacgccgaaatgcagggcttcgccgcgatagaaggcaagggcatcgaattcgtgttgacg
ctcggcaccggcgcgggaaccgcgctctttcgcgacggcgagttgatgcctcatctcgaa
ctcgcgcatcatccggtcagcaagaaaggcgtggcttatgacgagtacatcggcgacgca
gcacgcgaaaaagccgggaataaacgctggaataagcgtgttcacaaagtgatcggcatt
ctcgaatcgctcgtgaattacgacaagctatggattggcggcggcaacgcggcgcggctg
acattcgatttgcccgcgaacgttgcgaccgtttcgaacgatgcgggtattgaaggcggc
gcgcgcttatggcatccgaggtcggtgcgcgaaacgcggcaattgcccgaagcgaatgca
cgcacggggaagttcaaatag

DBGET integrated database retrieval system