KEGG   Burkholderia sp. HB1: AC233_26670Help
Entry
AC233_26670       CDS       T04094                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AC233_26670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buq02000]
    AC233_26670
Enzymes [BR:buq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AC233_26670
Transporters [BR:buq02000]
 Other Transporters
  Pores ion channels [TC:1]
   AC233_26670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALE58071
UniProt: A0A0M3TX90
LinkDB All DBs
Position
2:complement(1478933..1479604)
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYEIKRYERDPKTMLAPPELRAVHPLGKSPVITDDG
LTIAESGAIIEYLVDKYGQGRFAPAAGTPERLRYTYWLHYAEGSAMPPLLLKLIALRIAS
APMPFFAKPIARKIAGTLQSSFVDPQLKLHLGYIEDQLSKSTWFAGDEFSAADVQMSFPL
EAATARGGMRLPAVTAFLQRIHARAAYRRALERGGEYGVLGGG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgtccatcatttgaataactcgcgctcgcaacgcgtcttgtggctgctcgaa
gaactcggcgttccgtacgagatcaagcgctatgagcgcgatccaaaaacgatgctcgcg
ccgcccgagttgcgcgcggtgcatccgctcggcaagtcgccggttattaccgatgatggg
ctgaccatcgccgagtcgggcgcgattatcgaatatctggtcgacaagtatggacagggg
cgctttgcgccagcggccggcacccccgagcgtttgcgttacacgtactggctgcattac
gcggaagggtcggcgatgccgccgttgctgctgaagctgatcgcgctgcgtatcgcgagt
gcgccgatgcccttctttgcgaaaccgatcgcgcggaaaattgcggggacgctgcaatcg
agttttgtggatccgcagttgaagctgcatcttgggtatatcgaggatcagttgagtaag
agcacgtggtttgctggcgatgagttttctgccgccgatgtgcagatgagttttccgctt
gaggcggcgacggcgcgcggtgggatgcggctgcctgctgtgactgcgtttttgcagagg
attcatgcgcgcgcggcgtatcggcgggctttggagaggggtggggagtatggggttttg
ggtggggggtga

DBGET integrated database retrieval system