KEGG   Burkholderia sp. HB1: AC233_28240Help
Entry
AC233_28240       CDS       T04094                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K02483  two-component system, OmpR family, response regulator
Organism
buq  Burkholderia sp. HB1
Brite
KEGG Orthology (KO) [BR:buq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:buq02022]
    AC233_28240
Two-component system [BR:buq02022]
 OmpR family
  Unclassified
   AC233_28240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ALE58384
UniProt: A0A0M4PJW0
LinkDB All DBs
Position
2:1824124..1824864
Genome map
AA seq 246 aa AA seqDB search
MDTIDHVLIVDDDRGIRELIAGYLEKNGMRVSLAANGRQMRAALEQGAPDLIVLDLMMPG
EDGLVLCRELRAGKFRTVPVLMLTARNEEADRILGLEMGADDYLPKPFAVRELLARIRAV
LRRARMLPPGMQVTESAQMLGFGDWRLDTTARHLLDAEGTMVALSGAEYRLLRVFLDNPQ
RVLTRDQLLNLTQGRQADQFDRSIDLMVSRLRQRLRDEAREPRYIKTLRSEGYVFSAAVN
VIGDPQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatcgaccacgtactgatcgtcgacgacgaccgcggcattcgcgaactgatc
gccggctatctggagaagaacggcatgcgggtttcgctcgcggccaacgggcggcaaatg
cgcgcggctctcgagcagggcgcacccgacctgatcgtgctcgatctgatgatgcccggc
gaagacggcctcgtgctatgccgcgaactgcgcgcgggcaaatttcgcacggtgcccgtg
ctgatgctcaccgcgcgcaatgaagaagcggaccgcattctcggcctcgaaatgggcgcc
gacgactatctgcccaagccctttgccgtgcgcgaactgctcgcgcgcattcgcgcggtg
ctgcgccgcgcgcgcatgctgccgcccggcatgcaggtaacggaaagcgcgcaaatgctc
ggcttcggcgactggcggctcgacaccacggcgcgtcatctgctcgacgccgaaggcacg
atggtcgcgctaagcggcgccgaataccgcttgctgcgcgtattcctcgacaatccgcag
cgcgtgttgacacgcgatcaactgctcaatctcacgcaaggccgtcaggccgatcaattc
gaccgctcgatcgatctgatggtaagccgtctgcgtcagcgcttgcgcgacgaggcgcgc
gaaccgcgttacatcaagacgctgcgcagcgaaggctatgtgttttccgcggccgtgaac
gtgatcggggacccgcaatga

DBGET integrated database retrieval system