KEGG   Burkholderia lata: Bcep18194_A4649Help
Entry
Bcep18194_A4649   CDS       T00286                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bur  Burkholderia lata
Pathway
bur00020  Citrate cycle (TCA cycle)
bur00310  Lysine degradation
bur00380  Tryptophan metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
Module
bur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep18194_A4649
  09105 Amino acid metabolism
   00310 Lysine degradation
    Bcep18194_A4649
   00380 Tryptophan metabolism
    Bcep18194_A4649
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Bcep18194_A4649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABB08244
UniProt: Q39H22
LinkDB All DBs
Position
1:1635518..1638382
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGTNAND
VAHFPIVESFAERAKANAFIPRESTTNLAAARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESTRATPNFSADEKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHSGKRGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLAIQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVISAEDADNFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLACSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatacctcaacaatccggcatcggtgccggagaactgg
cgagagtatttcgacgcgttgcagaatgttcctgcaacggacggtacgaatgctaatgac
gtcgcccattttccgatcgtcgaatcgttcgccgagcgcgcgaaggccaatgccttcatc
ccgcgcgaaagcaccaccaatctggctgcggcacgcaagcaggtgcacgtccagtccctc
atcagcgcctatcgcttcctcggctcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccattcccgagctcgaacccgcgttctacgatttctccgaaggcgacctc
gaccagacgtacagcgcaagcaacctgtacttcggtttcgaccaggcttcgctgcgtgac
atcgtcaagggtctgcgcgacacgtattgcggcacgatcggcgccgaatacatgtacatc
agcgatccggagcagaagcgctggtggcaggagcgcctggagtcgacgcgcgcgacgccg
aacttctcggcagacgagaagaagcacatcctgaatcgcctgacggccgctgaaggcctc
gagcgctacctgcataccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcactcgggcaagcgcggcgtgcaggaa
atcatcatcggcatggcccaccgcggccgtctgaacgtgctggtcaacacgctgggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggt
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggtggcccggttcac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcc
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaagtgctgccggtgcag
atccacggtgacgcggccttcgctggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgatccgcgcgatgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaagcgccggtgctgcacgtgaacggcgacgatccggaagctgtcgtgctcgcg
atccagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggccacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcagcgcggaagacgccgacaacttcgtgaaggcgtaccgcaaggcgatg
gacgacggtcaccacacggtcgatccggtcctgtcgaactacaagagcaagtacgcggtt
gactgggttccgttcctgaaccgcaagtggacggatgcagccgacacggccgtgccgctc
gcagaactgaagcgcctcggcgaacgcatcacgacggtcccggaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgtggcgaccagccgctc
gactggggcatgggcgaacacctcgcgttcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgaccggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgcagaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctgacgatgctgctgccgcacggctatgaaggccagggtccg
gaacactcgtcgacgcgtatcgagcgtttcctgcaactgtgcgccgatcacaacatgcag
gtcgttcaaccgacgacgccggcacagattttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagcg
gtgtcggacctgtcggaactcgcgaagggttcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggcatgctcgggccgtgtgtattac
gacctcgtcgcacatcgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagctgtatccgttcgcgcacaagcagttcgaagccgaaatgaagaagtacgagaacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccatctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgtccggct
tcggcctcgccggcggttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgctttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system