KEGG   Burkholderia lata: Bcep18194_A5103Help
Entry
Bcep18194_A5103   CDS       T00286                                 

Definition
(GenBank) tRNA synthetase, class II (G, H, P and S)
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
bur  Burkholderia lata
Pathway
bur00340  Histidine metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Bcep18194_A5103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: ABB08697
UniProt: Q39FR9
LinkDB All DBs
Position
1:complement(2145641..2146789)
Genome map
AA seq 382 aa AA seqDB search
MSTWLLPENIADVLPSEARKIEELRRRLLDRFRSYGYEMVMPPLLEYLESLLTSGGADLR
LRTFKLVDQLSGRTLGLRADITPQVARIDAHLLNRQGVTRLCYAGHVMHTRPRGLHATRE
QIQIGAEIYGHAGLEADLEIQQLMLDALHLAGLSRIRLDLGHAGVLAALLARDAQAAERG
ESLYDALSGKDVPLLNELTDDLGADTRAALRALPHLYGDASVLAEARTRLPVLPEITRAL
DDLAQLAAQAKGAEVAIDLGDLRGYAYHSGAMFSAYIDGVPNAIARGGRYDHVGQAYGRA
RPATGFSLDLRELARISPVEARGTAILAPWAQDDALSAAVAALRDAGEVVIQALPGHDHV
LDEFACDRSLVERNGAWVVEPR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctggttacttcccgagaatatcgccgacgtgctgccgtcggaagcgcgcaag
atcgaggagctgcgccgcaggctgctcgaccgcttccgttcgtatggctacgaaatggtg
atgccgccgctgctcgagtatctcgagtcgctgctgacgagcggcggcgccgatctgcgc
ctgcgcaccttcaagctggtcgaccagctgtcgggccgcacgctcggcctgcgcgcggac
atcacgccgcaggtcgcgcggatcgacgcgcacctgttgaaccgccagggcgtgacgcgc
ctttgctatgcgggccacgtgatgcatacgcgtccgcgcggcctgcacgcgacgcgcgag
cagatccagatcggtgcggaaatctacgggcatgccgggctggaagccgatctcgaaatc
cagcaactgatgctcgacgcgctgcatctcgcaggcctgtcgcgtatccgtctcgacctc
ggccacgcgggcgtgctcgcggcgctgctggcgcgtgacgcgcaggctgccgagcgcggc
gagtcgctgtacgacgcgctgtcgggcaaggacgtgccgctactgaacgagctcaccgac
gatctcggcgccgatacgcgcgcggcgctgcgcgcgctgccgcacctctacggcgacgcg
agcgtgctcgccgaggcgcgcacgcgcttgccggtgctgcccgaaatcacgcgcgcgctc
gacgatctcgcgcaactcgcggcgcaggcgaagggtgcggaggtggcgatcgatctcggc
gacctgcgtggctatgcgtatcacagcggtgcgatgttcagcgcctacatcgacggtgtg
ccgaacgcaattgcgcggggcggccgttacgaccacgttggtcaggcgtacggccgtgcc
cgtccggctacgggcttctcgctcgacctgcgcgagctcgcgcggatttcgccggtcgag
gcgcgcggcaccgcgattctcgcgccgtgggcgcaggacgacgcgctgagcgcggccgtc
gcggcgctgcgcgatgcgggcgaggtcgtgatccaggcactgccgggccacgaccatgtg
ctcgacgagttcgcgtgcgaccgttcgctcgtcgagcgcaacggcgcatgggtggtcgaa
ccccgataa

DBGET integrated database retrieval system